3LQV: Branch Recognition by SF3b14

Branch Recognition by SF3b14. Determined by X-ray diffraction at 2.38 Å resolution. Released 26 Jan 2011.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,645
Mol. weight: 36.84 kDa
Ligands: ADE
Released: 26 Jan 2011

Explore 3LQV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LQV contains 15 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	1
α-helix	32-40	9
β-strand	45-51	7	1
β-strand	60-64	5	1
α-helix	67-77	11
β-strand	81	1	2
β-strand	86	1	2
β-strand	88-91	4	1
α-helix	94-97	4
α-helix	103-117	15
α-helix	123-124	2

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	3
α-helix	32-39	8
α-helix	40-42	3
β-strand	45-51	7	3
β-strand	59-64	6	3
α-helix	67-77	11
β-strand	81	1	4
β-strand	86	1	4
β-strand	88-91	4	3
α-helix	94-97	4
α-helix	103-117	15

Chain P: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	380-394	15
α-helix	397-400	4
α-helix	401-406	6
β-strand	412-414	3	1

Chain Q: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	380-396	17
α-helix	401-406	6
β-strand	412-414	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA branch site protein p14	A, B	protein	115	Homo sapiens	Q9Y3B4 (AlphaFold model)
Splicing factor 3B subunit 1	P, Q	protein	39	Homo sapiens	O75533 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LQV_1 Pre-mRNA branch site protein p14 (chains A, B)
IRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDA
KNAVDHLSGFNVSNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Sequence of entity 2 (P, Q), FASTA

>3LQV_2 Splicing factor 3B subunit 1 (chains P, Q)
SMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVL

Ligands and cofactors

ID	Name	Formula	Copies
ADE	Adenine	C5 H5 N5	2

Primary citation

Branch Recognition by SF3b14. Schellenberg, M.J., Dul, E.L., MacMillan, A.M. RNA (2011) 17:155-165. DOI 10.1261/rna.2224411 · PubMed

Other PDB entries of the same protein (UniProt Q9Y3B4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Q4O 2.1 Å, Substrate-bound A-like U2 snRNP
2F9D 2.5 Å, 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of…
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
7DVQ 2.89 Å, Cryo-EM Structure of the Activated Human Minor Spliceosome (minor Bact Complex)
2F9J 3.0 Å, 3.0 angstrom resolution structure of a Y22M mutant of the spliceosomal protein p14 bound…
8I0R 3.0 Å, The cryo-EM structure of human Bact-I complex
8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.
8H6J 3.25 Å, Cryo-EM structure of human exon-defined spliceosome in the mature pre-B state.
9ZE2 3.26 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (core)
6FF4 3.4 Å, human Bact spliceosome core structure
8I0P 3.4 Å, The cryo-EM structure of human pre-Bact complex

Browse structure collections

About this viewer

MolViewer shows 3LQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.