2F9N: Alpha I tryptase

Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant K192Q/D216G in Complex with Leupeptin. Determined by X-ray diffraction at 1.6 Å resolution. Released 31 Jan 2006.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Homo sapiens, Actinomycetes Streptomyces roseus MA 839-A1
Chains: 8
Atoms: 9,588
Mol. weight: 114.59 kDa
Ligands: BU3, NAG
Released: 31 Jan 2006

Explore 2F9N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2F9N contains 41 α-helices and 108 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-36	7	3
β-strand	38-48	11	3
β-strand	51-54	4	3
α-helix	56-59	4
β-strand	60B	1	4
α-helix	60C-60D	2
α-helix	61-63	3
β-strand	64-67	4	3
β-strand	72	1	5
β-strand	83	1	3
β-strand	85-90	6	3
β-strand	104-108	5	3
α-helix	111-114	4
β-strand	122	1	2
α-helix	123-125	3
β-strand	136-140	5	2
β-strand	145	1	6
β-strand	149	1	6
α-helix	150-152	3
β-strand	154	1	5
β-strand	156-159	4	2
β-strand	162-163	2	2
α-helix	165-173	9
β-strand	173C	1	7
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-203	6	2
β-strand	206-215	10	2
β-strand	221A	1	8
β-strand	224	1	8
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-241	7

Chain B: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	9
β-strand	20-21	2	10
α-helix	22-23	2
β-strand	30-36	7	11
β-strand	38-48	11	11
β-strand	51-54	4	11
α-helix	56-59	4
β-strand	60B	1	12
α-helix	60C-60E	3
α-helix	61-63	3
β-strand	64-67	4	11
β-strand	72	1	13
β-strand	83	1	11
β-strand	85-90	6	11
β-strand	104-108	5	11
α-helix	111-114	4
β-strand	122	1	10
α-helix	123-125	3
β-strand	136-140	5	10
β-strand	145	1	14
β-strand	149	1	14
α-helix	150-152	3
β-strand	154	1	13
β-strand	156-159	4	10
β-strand	162-163	2	10
α-helix	165-173	9
β-strand	173C	1	15
β-strand	180-183	4	10
β-strand	189	1	9
β-strand	198-203	6	10
β-strand	206-215	10	10
β-strand	221A	1	16
β-strand	224	1	16
β-strand	226-230	5	10
α-helix	231-234	4
α-helix	235-241	7

Chain C: 11 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	17
β-strand	20-21	2	18
α-helix	22-23	2
β-strand	30-36	7	19
β-strand	38-48	11	19
β-strand	51-54	4	19
α-helix	56-59	4
β-strand	60B	1	15
α-helix	60C-60D	2
α-helix	61-63	3
β-strand	64-67	4	19
β-strand	72	1	20
β-strand	83	1	19
β-strand	85-90	6	19
β-strand	104-108	5	19
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	18
α-helix	123-125	3
β-strand	136-140	5	18
β-strand	145	1	21
β-strand	149	1	21
α-helix	150-152	3
β-strand	154	1	20
β-strand	156-159	4	18
β-strand	162-163	2	18
α-helix	165-173	9
β-strand	173C	1	12
β-strand	180-183	4	18
β-strand	189	1	17
β-strand	198-203	6	18
β-strand	206-215	10	18
β-strand	221A	1	22
β-strand	224	1	22
β-strand	226-230	5	18
α-helix	231-234	4
α-helix	235-238	4

Chain D: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	23
β-strand	20-21	2	24
α-helix	22-23	2
β-strand	30-36	7	25
β-strand	38-48	11	25
β-strand	51-54	4	25
α-helix	56-59	4
β-strand	60B	1	7
α-helix	60C-60E	3
α-helix	61-63	3
β-strand	64-67	4	25
β-strand	72	1	26
β-strand	83	1	25
β-strand	85-90	6	25
β-strand	104-108	5	25
α-helix	111-114	4
β-strand	122	1	24
α-helix	123-125	3
β-strand	136-140	5	24
β-strand	145	1	27
β-strand	149	1	27
α-helix	150-152	3
β-strand	154	1	26
β-strand	156-160	5	24
β-strand	162-163	2	24
α-helix	165-173	9
β-strand	173C	1	4
β-strand	180-183	4	24
β-strand	189	1	23
β-strand	198-203	6	24
β-strand	206-215	10	24
β-strand	221A	1	28
β-strand	224	1	28
β-strand	226-230	5	24
α-helix	231-234	4
α-helix	235-239	5

Chains E, F, G and H: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	303	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
alpha I tryptase	A, B, C, D	protein	245	Homo sapiens	Q15661 (AlphaFold model)
Leupeptin	E, F, G, H	protein	4	Actinomycetes Streptomyces roseus MA 839-A1

Sequence of entity 1 (A, B, C, D), FASTA

>2F9N_1 alpha I tryptase (chains A, B, C, D)
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLATLRVQL
REQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFP
PGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDML
CAGNSQRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHY
VPKKP

Sequence of entity 2 (E, F, G, H), FASTA

>2F9N_2 Leupeptin (chains E, F, G, H)
XLLR

Ligands and cofactors

ID	Name	Formula	Copies
BU3	(r,r)-2,3-butanediol	C4 H10 O2	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

X-ray Structures of Free and Leupeptin-complexed Human alpha I-Tryptase Mutants: Indication for an alpha to beta-Tryptase Transition. Rohr, K.B., Selwood, T., Marquardt, U. et al. J Mol Biol (2005) 357:195-209. DOI 10.1016/j.jmb.2005.12.037 · PubMed

Other PDB entries of the same protein (UniProt Q15661 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MPU 1.65 Å, Human beta-tryptase co-crystal structure with (6S,8R)-N,N'-bis[3-({4-[3-(aminomethyl)phen…
5F03 1.94 Å, TRYPTASE B2 IN COMPLEX WITH 5-(3-Aminomethyl-phenoxymethyl)-3-[3-(2-chloro-pyridin-3-ylet…
4MPW 1.95 Å, Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di…
4MPX 2.0 Å, Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di…
2ZEC 2.06 Å, Potent, Nonpeptide Inhibitors of Human Mast Cell Tryptase
2F9O 2.1 Å, Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant D216G
6O1F 2.15 Å, Complex between soybean trypsin inhibitor beta1-tryptase and a humanized fab
1LTO 2.2 Å, Human alpha1-tryptase
4MQA 2.25 Å, Human beta-tryptase co-crystal structure with {(1,1,3,3-tetramethyldisiloxane-1,3-diyl)bi…
2F9P 2.3 Å, Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant D216G in Complex with…
4MPV 2.31 Å, Human beta-tryptase co-crystal structure with (2R,4S)-N,N'-bis[3-({4-[3-(aminomethyl)phen…
8VGK 2.4 Å, CryoEM structure of tryptase in complex with engineered conformationally rigid…

Browse structure collections

About this viewer

MolViewer shows 2F9N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.