TRYPTASE B2 IN COMPLEX WITH 5-(3-Aminomethyl-phenoxymethyl)-3-[3-(2-chloro-pyridin-3-ylethynyl)-phenyl]-oxazolidin-2-one; compound with trifluoro-acetic acid. Determined by X-ray diffraction at 1.94 Å resolution. Released 24 Feb 2016.
Explore 5F03 in 3D Show helices and sheets RCSB PDB PDBe
5F03 contains 19 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 3 |
| β-strand | 39-48 | 10 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58 | 3 | |
| α-helix | 61-63 | 3 | |
| β-strand | 64-67 | 4 | 3 |
| β-strand | 72 | 1 | 4 |
| β-strand | 83 | 1 | 3 |
| β-strand | 85-90 | 6 | 3 |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 111-113 | 3 | |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-125 | 3 | |
| β-strand | 136-140 | 5 | 2 |
| β-strand | 145 | 1 | 5 |
| β-strand | 149 | 1 | 5 |
| α-helix | 150-152 | 3 | |
| β-strand | 154 | 1 | 4 |
| β-strand | 156-160 | 5 | 2 |
| β-strand | 162-163 | 2 | 2 |
| α-helix | 165-173 | 9 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-203 | 6 | 2 |
| β-strand | 206-215 | 10 | 2 |
| β-strand | 221A | 1 | 6 |
| β-strand | 224 | 1 | 6 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-241 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 7 |
| β-strand | 20-21 | 2 | 8 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 9 |
| β-strand | 39-48 | 10 | 9 |
| β-strand | 51-54 | 4 | 9 |
| α-helix | 56-59 | 4 | |
| α-helix | 61-63 | 3 | |
| β-strand | 64-67 | 4 | 9 |
| β-strand | 72 | 1 | 10 |
| β-strand | 83 | 1 | 9 |
| β-strand | 85-90 | 6 | 9 |
| β-strand | 104-108 | 5 | 9 |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 8 |
| α-helix | 123-125 | 3 | |
| β-strand | 135-140 | 6 | 8 |
| β-strand | 145 | 1 | 11 |
| β-strand | 149 | 1 | 11 |
| α-helix | 150-152 | 3 | |
| β-strand | 154 | 1 | 10 |
| β-strand | 156-163 | 8 | 8 |
| α-helix | 165-173 | 9 | |
| β-strand | 180-183 | 4 | 8 |
| β-strand | 189 | 1 | 7 |
| β-strand | 198-203 | 6 | 8 |
| β-strand | 206-215 | 10 | 8 |
| β-strand | 221A | 1 | 12 |
| β-strand | 224 | 1 | 12 |
| β-strand | 226-230 | 5 | 8 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-241 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tryptase beta-2 | A, B | protein | 245 | Homo sapiens | Q15661 (AlphaFold model) |
>5F03_1 Tryptase beta-2 (chains A, B) IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQL REQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFP PGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDML CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHY VPKKP
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5TA | (5~{S})-5-[[3-(aminomethyl)phenoxy]methyl]-3-[3-[2-(2-chloranylpyridin-3-yl)eth… | C24 H20 Cl N3 O3 | 2 |
A Real-World Perspective on Molecular Design. Kuhn, B., Guba, W., Hert, J. et al. J Med Chem (2016) 59:4087-4102. DOI 10.1021/acs.jmedchem.5b01875 · PubMed
Other PDB entries of the same protein (UniProt Q15661 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5F03 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.