Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benzofuran-3,5-diyl]bis({4-[3-(aminomethyl)phenyl]piperidin-1-yl}methanone). Determined by X-ray diffraction at 1.95 Å resolution. Released 18 Mar 2015.
Explore 4MPW in 3D Show helices and sheets RCSB PDB PDBe
4MPW contains 19 α-helices and 49 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32 | 1 | 1 |
| β-strand | 35-36 | 2 | 2 |
| α-helix | 37-38 | 2 | |
| β-strand | 45-50 | 6 | 3 |
| β-strand | 56-65 | 10 | 3 |
| β-strand | 68-71 | 4 | 3 |
| α-helix | 73-75 | 3 | |
| β-strand | 79 | 1 | 4 |
| α-helix | 83-85 | 3 | |
| β-strand | 86-89 | 4 | 3 |
| β-strand | 94 | 1 | 5 |
| β-strand | 102-109 | 8 | 3 |
| β-strand | 123-127 | 5 | 3 |
| α-helix | 130-133 | 4 | |
| α-helix | 139-140 | 2 | |
| β-strand | 141 | 1 | 2 |
| α-helix | 142-144 | 3 | |
| β-strand | 155-159 | 5 | 2 |
| β-strand | 164 | 1 | 6 |
| β-strand | 167 | 1 | 6 |
| α-helix | 168-170 | 3 | |
| β-strand | 174 | 1 | 5 |
| β-strand | 176-179 | 4 | 2 |
| β-strand | 182-183 | 2 | 2 |
| α-helix | 185-193 | 9 | |
| β-strand | 196 | 1 | 7 |
| β-strand | 209-212 | 4 | 2 |
| β-strand | 218 | 1 | 1 |
| β-strand | 227-232 | 6 | 2 |
| β-strand | 235-244 | 10 | 2 |
| β-strand | 250 | 1 | 8 |
| β-strand | 253 | 1 | 8 |
| β-strand | 255-259 | 5 | 2 |
| α-helix | 260-263 | 4 | |
| α-helix | 264-270 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32 | 1 | 9 |
| β-strand | 35-36 | 2 | 10 |
| α-helix | 37-38 | 2 | |
| β-strand | 45-50 | 6 | 11 |
| β-strand | 56-65 | 10 | 11 |
| β-strand | 68-71 | 4 | 11 |
| α-helix | 73-76 | 4 | |
| β-strand | 79 | 1 | 7 |
| α-helix | 83-85 | 3 | |
| β-strand | 86-89 | 4 | 11 |
| β-strand | 94 | 1 | 12 |
| β-strand | 102-109 | 8 | 11 |
| β-strand | 123-127 | 5 | 11 |
| α-helix | 139-140 | 2 | |
| β-strand | 141 | 1 | 10 |
| α-helix | 142-144 | 3 | |
| β-strand | 154-159 | 6 | 10 |
| β-strand | 164 | 1 | 13 |
| β-strand | 167 | 1 | 13 |
| α-helix | 168-170 | 3 | |
| β-strand | 174 | 1 | 12 |
| β-strand | 176-183 | 8 | 10 |
| α-helix | 185-193 | 9 | |
| β-strand | 196 | 1 | 4 |
| β-strand | 209-212 | 4 | 10 |
| β-strand | 218 | 1 | 9 |
| β-strand | 227-232 | 6 | 10 |
| β-strand | 235-244 | 10 | 10 |
| β-strand | 250 | 1 | 14 |
| β-strand | 253 | 1 | 14 |
| β-strand | 255-259 | 5 | 10 |
| α-helix | 260-263 | 4 | |
| α-helix | 264-270 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tryptase alpha/beta-1 | A, B | protein | 245 | Homo sapiens | Q15661 (AlphaFold model) |
>4MPW_1 Tryptase alpha/beta-1 (chains A, B) IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQL REQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFP PGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDML CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHY VPKKP
| ID | Name | Formula | Copies |
|---|---|---|---|
| 2AJ | [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benzofuran-3,5-diyl]bis({4-[3-(am… | C46 H54 N4 O5 Si2 | 1 |
Water and common crystallization additives (CL, PGE, ACT) are not listed.
A Novel, Nonpeptidic, Orally Active Bivalent Inhibitor of Human beta-Tryptase. Giardina, S.F., Werner, D.S., Pingle, M. et al. Pharmacology (2018) 102:233-243. DOI 10.1159/000492078 · PubMed
Other PDB entries of the same protein (UniProt Q15661 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4MPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.