2FAZ: PDB entry 2FAZ

Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95. Determined by X-ray diffraction at 2.0 Å resolution. Released 20 Dec 2005.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,353
Mol. weight: 18.69 kDa
Released: 20 Dec 2005

Explore 2FAZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FAZ contains 8 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	1
β-strand	13-19	7	1
β-strand	24	1	2
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	1
β-strand	50-51	2	1
α-helix	52	1
β-strand	57	1	2
β-strand	68-73	6	1

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	1
β-strand	13-19	7	1
β-strand	24	1	3
α-helix	25-36	12
α-helix	40-42	3
β-strand	45-47	3	1
β-strand	50-51	2	1
α-helix	52	1
β-strand	57	1	3
α-helix	58-61	4
α-helix	63-64	2
β-strand	68-71	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like containing PHD and RING finger domains protein 1	A, B	protein	78	Homo sapiens	Q96T88 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2FAZ_1 Ubiquitin-like containing PHD and RING finger domains protein 1 (chains A, B)
GSMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTL
FDYEVRLNDTIQLLVRQS

Primary citation

Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95. Walker, J.R., Wybenga-Groot, L., Doherty, R.S. et al. To be published.

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W92 1.3 Å, Human UHRF1 TTD domain
6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
3ZVZ 1.45 Å, PHD finger of human UHRF1
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
3BI7 1.7 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
5YYA 1.7 Å, Crystal structure of Tandem Tudor Domain of human UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1

Browse structure collections

About this viewer

MolViewer shows 2FAZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.