3ZVZ: PHD finger of human UHRF1

PHD finger of human UHRF1. Determined by X-ray diffraction at 1.45 Å resolution. Released 30 Nov 2011.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 554
Mol. weight: 6.63 kDa
Ligands: ZN
Released: 30 Nov 2011

Explore 3ZVZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZVZ contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	312-314	3
β-strand	318	1	1
α-helix	327-329	3
β-strand	330-332	3	1
β-strand	339-341	3	1
α-helix	348-349	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	B	protein	57	HOMO SAPIENS	Q96T88 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3ZVZ_1 E3 UBIQUITIN-PROTEIN LIGASE UHRF1 (chains B)
GHMRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The Phd Finger of Human Uhrf1 Reveals a New Subgroup of Unmethylated Histone H3 Tail Readers. Lallous, N., Legrand, P., Mcewen, A.G. et al. PLoS One (2011) 6:27599. DOI 10.1371/JOURNAL.PONE.0027599 · PubMed

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W92 1.3 Å, Human UHRF1 TTD domain
6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
3BI7 1.7 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
5YYA 1.7 Å, Crystal structure of Tandem Tudor Domain of human UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1
3SHB 1.8 Å, Crystal Structure of PHD Domain of UHRF1

Browse structure collections

About this viewer

MolViewer shows 3ZVZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.