6W92: Human UHRF1 TTD domain

Human UHRF1 TTD domain. Determined by X-ray diffraction at 1.3 Å resolution. Released 24 Feb 2021.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,493
Mol. weight: 19.21 kDa
Released: 24 Feb 2021

Explore 6W92 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W92 contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	128-130	3	1
β-strand	142-146	5	1
β-strand	153-164	12	1
α-helix	165-167	3
α-helix	181-183	3
β-strand	185-190	6	1
α-helix	194-196	3
β-strand	198-202	5	1
α-helix	203-205	3
β-strand	206-207	2	1
α-helix	208-210	3
β-strand	213	1	2
α-helix	216-218	3
β-strand	224-229	6	2
β-strand	239-250	12	2
β-strand	255-261	7	2
β-strand	268-272	5	2
α-helix	273	1
α-helix	279	1
β-strand	280	1	2
α-helix	281-283	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A	protein	164	Homo sapiens	Q96T88 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6W92_1 E3 ubiquitin-protein ligase UHRF1 (chains A)
SNADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALE
EDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWY
DAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERP

Primary citation

Discovery of small molecules targeting the tandem tudor domain of the epigenetic factor UHRF1 using fragment-based ligand discovery. Chang, L., Campbell, J., Raji, I.O. et al. Sci Rep (2021) 11:1121-1121. DOI 10.1038/s41598-020-80588-4 · PubMed

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
3ZVZ 1.45 Å, PHD finger of human UHRF1
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
3BI7 1.7 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
5YYA 1.7 Å, Crystal structure of Tandem Tudor Domain of human UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1
3SHB 1.8 Å, Crystal Structure of PHD Domain of UHRF1

Browse structure collections

About this viewer

MolViewer shows 6W92 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.