2FHS: Acyl Carrier Protein

Structure of Acyl Carrier Protein Bound to FabI, the Enoyl Reductase from Escherichia Coli. Determined by X-ray diffraction at 2.7 Å resolution. Released 17 Oct 2006.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Escherichia coli
Chains: 3
Atoms: 4,020
Mol. weight: 64.43 kDa
Released: 17 Oct 2006

Explore 2FHS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FHS contains 39 α-helices and 14 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
α-helix	20-30	11
β-strand	34-39	6	1
α-helix	42-44	3
α-helix	45-54	10
β-strand	60-62	3	1
α-helix	68-81	14
β-strand	88-90	3	1
α-helix	97-100	4
α-helix	104-107	4
α-helix	110-117	8
α-helix	118-122	5
α-helix	123-131	9
α-helix	135-136	2
β-strand	139-145	7	1
α-helix	147-149	3
α-helix	158-177	20
α-helix	178-180	3
β-strand	182-189	8	1
α-helix	190-191	2
α-helix	201-213	13
α-helix	222-233	12
α-helix	235-237	3
β-strand	244-247	4	1
α-helix	251-253	3

Chain B: 16 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	2
α-helix	20-30	11
β-strand	34-39	6	2
α-helix	42-54	13
β-strand	60-62	3	2
α-helix	68-81	14
β-strand	85-90	6	2
α-helix	104-107	4
α-helix	110-116	7
α-helix	117-122	6
α-helix	123-131	9
α-helix	132-134	3
β-strand	135-145	11	2
α-helix	147-149	3
α-helix	158-177	20
α-helix	178-180	3
β-strand	183-189	7	2
α-helix	190-191	2
α-helix	204-213	10
α-helix	222-232	11
α-helix	235-237	3
β-strand	244-247	4	2
α-helix	251-253	3

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	4-7	4
α-helix	38-40	3
α-helix	41-50	10
α-helix	67-69	3
α-helix	72-75	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
enoyl-[acyl-carrier-protein] reductase, NADH-dependent	A, B	protein	262	Escherichia coli	P0AEK4 (AlphaFold model)
Acyl carrier protein	C	protein	78	Escherichia coli	P0A6A8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2FHS_1 enoyl-[acyl-carrier-protein] reductase, NADH-dependent (chains A, B)
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK

Sequence of entity 2 (C), FASTA

>2FHS_2 Acyl carrier protein (chains C)
MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA
EKITTVQAAIDYINGHQA

Primary citation

Structure of Acyl Carrier Protein Bound to FabI, the FASII Enoyl Reductase from Escherichia coli. Rafi, S., Novichenok, P., Kolappan, S. et al. J Biol Chem (2006) 281:39285-39293. DOI 10.1074/jbc.M608758200 · PubMed

Other PDB entries of the same protein (UniProt P0AEK4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UMW 1.54 Å, Crystal structure of E. Coli FabI in complex with NAD and Fabimycin…
7UM8 1.7 Å, Crystal structure of E. Coli FabI in complex with NAD and…
1QSG 1.75 Å, Crystal structure of enoyl reductase inhibition by triclosan
4CV2 1.8 Å, Crystal structure of E. coli FabI in complex with NADH and CG400549
1QG6 1.9 Å, Crystal structure of E. Coli enoyl acyl carrier protein reductase in complex with NAD…
3PJF 1.9 Å, Structure of ENR G93V mutant-NAD+-triclosan complex
4CV3 1.95 Å, Crystal structure of E. coli FabI in complex with NADH and PT166
5CFZ 1.97 Å, Crystal structure of E. coli FabI in apo form
1C14 2.0 Å, Crystal structure of E coli enoyl reductase-NAD+-triclosan complex
4D46 2.0 Å, Crystal structure of E. coli FabI in complex with NAD and…
5CG1 2.07 Å, Crystal structure of E. coli FabI bound to the carbamoylated benzodiazaborine inhibitor…
1DFI 2.09 Å, X-ray structure of escherichia coli enoyl reductase with bound NAD

Browse structure collections

About this viewer

MolViewer shows 2FHS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.