2FMA: Amyloid beta A4 protein precursor

Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in 'small unit cell' form, atomic resolution. Determined by X-ray diffraction at 0.85 Å resolution. Released 16 Jan 2007.

Method: X-ray diffraction
Resolution: 0.85 Å
Organism: Homo sapiens
Chains: 1
Atoms: 613
Mol. weight: 6.94 kDa
Released: 16 Jan 2007

Explore 2FMA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FMA contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	134-139	6	1
β-strand	145	1	1
α-helix	147-160	14
β-strand	163-174	12	1
β-strand	178-188	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid beta A4 protein precursor	A	protein	59	Homo sapiens	P05067 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FMA_1 Amyloid beta A4 protein precursor (chains A)
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL

Primary citation

Structure of Alzheimer's disease amyloid precursor protein copper-binding domain at atomic resolution. Kong, G.K., Adams, J.J., Cappai, R. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2007) 63:819-824. DOI 10.1107/S1744309107041139 · PubMed

Other PDB entries of the same protein (UniProt P05067 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NB9 1.05 Å, Amyloid-Beta (20-34) with L-isoaspartate 23
6OIZ 1.1 Å, Amyloid-Beta (20-34) wild type
8T82 1.1 Å, Racemic mixture of amyloid beta segment 35-MVGGVV-40 forms heterochiral rippled…
5ONQ 1.17 Å, Alzheimer's Amyloid-Beta Peptide Fragment 29-40 in Complex with Cd-substituted Thermolysin
3JQL 1.2 Å, Crystal Structure of the Complex Formed Between Phospholipase A2 and a Hexapeptide…
3PZZ 1.29 Å, Structure of an amyloid forming peptide GAIIGL (29-34) from amyloid beta
4PQD 1.33 Å, The longer crystal structure of the grow factor like domain from Beta amypoid precusor…
5ONP 1.34 Å, Alzheimer's Amyloid-Beta Peptide Fragment 1-40 in Complex with Cd-substituted Thermolysin
5ONR 1.39 Å, Alzheimer's Amyloid-Beta Peptide Fragment 1-40 in Complex with Thermolysin
4PWQ 1.4 Å, High-resolution crystal structure of the E1-domain of the amyloid precursor protein
7OW1 1.4 Å, Crystal Structure of TAP01 in complex with amyloid beta peptide
6O4J 1.4 Å, Amyloid Beta KLVFFAENVGS 16-26 D23N Iowa mutation

Browse structure collections

About this viewer

MolViewer shows 2FMA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.