2FOW: Ribosomal protein L11

The RNA binding domain of ribosomal protein L11: three-dimensional structure of the RNA-bound form of the protein, NMR, 26 structures. Determined by solution NMR. Released 26 Nov 1997.

Method: Solution NMR
Organism: Geobacillus stearothermophilus
Chains: 1
Atoms: 566
Mol. weight: 8.15 kDa
Released: 26 Nov 1997

Explore 2FOW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FOW contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-17	8
β-strand	33-36	4	1
α-helix	37-46	10
α-helix	56-68	13
β-strand	72-75	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein L11	A	protein	76	Geobacillus stearothermophilus	P56210 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FOW_1 RIBOSOMAL PROTEIN L11 (chains A)
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAM
RMIEGTARSMGIVVED

Primary citation

The RNA binding domain of ribosomal protein L11: three-dimensional structure of the RNA-bound form of the protein and its interaction with 23 S rRNA. Hinck, A.P., Markus, M.A., Huang, S. et al. J Mol Biol (1997) 274:101-113. DOI 10.1006/jmbi.1997.1379 · PubMed

Other PDB entries of the same protein (UniProt P56210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HC8 2.8 Å, Crystal structure of a conserved ribosomal protein-RNA complex
1QA6 2.8 Å, Crystal structure of a conserved ribosomal protein-RNA complex
1Y39 2.8 Å, Co-evolution of protein and RNA structures within a highly conserved ribosomal domain
1C04 5.0 Å, Identification of known protein and RNA structures in a 5 a map of the large ribosomal…
1ACI L11 ribosomal protein RNA binding domain, NMR, 20 structures
1FOW NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, minimized…
1FOX NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, 33…
1FOY The RNA binding domain of ribosomal protein L11: three-dimensional structure of the…

Browse structure collections

About this viewer

MolViewer shows 2FOW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.