Solution structure of the second SH3 domain of human adaptor protein NCK2. Determined by solution NMR. Released 20 Jun 2006.
Explore 2FRW in 3D Show helices and sheets RCSB PDB PDBe
2FRW contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 1 |
| β-strand | 9 | 1 | 2 |
| β-strand | 13 | 1 | 3 |
| β-strand | 16 | 1 | 3 |
| α-helix | 18 | 1 | |
| β-strand | 19 | 1 | 2 |
| α-helix | 20 | 1 | |
| β-strand | 24-25 | 2 | 1 |
| β-strand | 26 | 1 | 4 |
| β-strand | 37-40 | 4 | 4 |
| β-strand | 43-46 | 4 | 4 |
| α-helix | 49-51 | 3 | |
| β-strand | 52-53 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoplasmic protein NCK2 | A | protein | 57 | Homo sapiens | O43639 (AlphaFold model) |
>2FRW_1 Cytoplasmic protein NCK2 (chains A) IPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVD
Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins. Liu, J., Li, M., Ran, X. et al. Biochemistry (2006) 45:7171-7184. DOI 10.1021/bi060091y · PubMed
Other PDB entries of the same protein (UniProt O43639 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2FRW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.