Solution structure of the third SH3 domain of human NCK2 adaptor protein. Determined by solution NMR. Released 20 Jun 2006.
Explore 2FRY in 3D Show helices and sheets RCSB PDB PDBe
2FRY contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-7 | 3 | 1 |
| α-helix | 11-13 | 3 | |
| β-strand | 18 | 1 | 2 |
| β-strand | 26-27 | 2 | 1 |
| β-strand | 29 | 1 | 2 |
| β-strand | 40-43 | 4 | 2 |
| β-strand | 49-52 | 4 | 2 |
| α-helix | 54-56 | 3 | |
| β-strand | 57-59 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoplasmic protein NCK2 | A | protein | 61 | Homo sapiens | O43639 (AlphaFold model) |
>2FRY_1 Cytoplasmic protein NCK2 (chains A) GSHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVL S
Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins. Liu, J., Li, M., Ran, X. et al. Biochemistry (2006) 45:7171-7184. DOI 10.1021/bi060091y · PubMed
Other PDB entries of the same protein (UniProt O43639 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2FRY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.