2FSZ: Estrogen receptor beta

A second binding site for hydroxytamoxifen within the coactivator-binding groove of estrogen receptor beta. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Jul 2006.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,717
Mol. weight: 57.04 kDa
Ligands: OHT
Released: 11 Jul 2006

Explore 2FSZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FSZ contains 23 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	265-273	9
α-helix	276-281	6
α-helix	291-315	25
α-helix	319-321	3
α-helix	324-347	24
β-strand	353-357	5	1
β-strand	360-363	4	1
α-helix	364-369	6
α-helix	373-389	17
α-helix	394-406	13
α-helix	424-442	19
α-helix	448-478	31
α-helix	488-496	9

Chain B: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	261-263	3
α-helix	265-275	11
α-helix	277-281	5
β-strand	283	1	2
α-helix	291-313	23
α-helix	319-321	3
α-helix	324-347	24
β-strand	353-357	5	3
β-strand	359	1	2
β-strand	360-363	4	3
α-helix	364-369	6
α-helix	373-389	17
α-helix	394-406	13
α-helix	424-442	19
α-helix	449-478	30
α-helix	488-497	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Estrogen receptor beta	A, B	protein	246	Homo sapiens	Q92731 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2FSZ_1 Estrogen receptor beta (chains A, B)
ELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKI
PGFVELSLFDQVRLLESSWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKSVEGILEI
FDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDA
LVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKSKNVVPVYDLLLEMLN
AHVLRG

Ligands and cofactors

ID	Name	Formula	Copies
OHT	4-hydroxytamoxifen	C26 H29 N O2	4

Primary citation

A second binding site for hydroxytamoxifen within the coactivator-binding groove of estrogen receptor beta. Wang, Y., Chirgadze, N.Y., Briggs, S.L. et al. Proc Natl Acad Sci U S A (2006) 103:9908-9911. DOI 10.1073/pnas.0510596103 · PubMed

Other PDB entries of the same protein (UniProt Q92731 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OLL 1.5 Å, Crystal structure of phosphorylated estrogen receptor beta ligand binding domain
7XVY 1.54 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with S-DPN
1QKM 1.8 Å, Human oestrogen receptor beta ligand-binding domain in complex with partial agonist…
7XWQ 1.89 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
7XWP 1.92 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
2YJD 1.93 Å, Stapled peptide bound to Estrogen Receptor Beta
3OMQ 1.97 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
9ECF 2.0 Å, Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide…
1YYE 2.03 Å, Crystal structure of estrogen receptor beta complexed with way-202196
3OMP 2.05 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
7XVZ 2.08 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
2NV7 2.1 Å, Crystal Structure of Estrogen Receptor Beta Complexed with WAY-555

Browse structure collections

About this viewer

MolViewer shows 2FSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.