Crystal structure of phosphorylated estrogen receptor beta ligand binding domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 17 Nov 2010.
Explore 3OLL in 3D Show helices and sheets RCSB PDB PDBe
3OLL contains 26 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 265-275 | 11 | |
| α-helix | 276-281 | 6 | |
| β-strand | 283 | 1 | 1 |
| α-helix | 288-289 | 2 | |
| α-helix | 291-314 | 24 | |
| α-helix | 319-321 | 3 | |
| α-helix | 324-347 | 24 | |
| β-strand | 353-357 | 5 | 2 |
| β-strand | 359 | 1 | 1 |
| β-strand | 360-363 | 4 | 2 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 421-442 | 22 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-497 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-281 | 6 | |
| β-strand | 283 | 1 | 3 |
| α-helix | 288-289 | 2 | |
| α-helix | 291-314 | 24 | |
| α-helix | 319-321 | 3 | |
| α-helix | 324-347 | 24 | |
| β-strand | 353-357 | 5 | 4 |
| β-strand | 359 | 1 | 3 |
| β-strand | 360-363 | 4 | 4 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 422-442 | 21 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-497 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-9 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Estrogen receptor beta | A, B | protein | 240 | Homo sapiens | Q92731 (AlphaFold model) |
| Nuclear receptor coactivator 1 | C, D | protein | 19 | Homo sapiens | Q15788 (AlphaFold model) |
>3OLL_1 Estrogen receptor beta (chains A, B) DALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFV ELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDML LATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWV IAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVL
>3OLL_2 Nuclear receptor coactivator 1 (chains C, D) LTERHKILHRLLQEGSPSD
| ID | Name | Formula | Copies |
|---|---|---|---|
| EST | Estradiol | C18 H24 O2 | 2 |
Synthesis and crystal structure of a phosphorylated estrogen receptor ligand binding domain. Mocklinghoff, S., Rose, R., Carraz, M. et al. Chembiochem (2010) 11:2251-2254. DOI 10.1002/cbic.201000532 · PubMed
Other PDB entries of the same protein (UniProt Q92731 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3OLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.