9ECF: HERbeta LBD
Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide (crystal form 2). Determined by X-ray diffraction at 2.0 Å resolution. Released 19 Nov 2025.
- Method
- X-ray diffraction
- Resolution
- 2.0 Å
- Organism
- Homo sapiens
- Chains
- 16
- Atoms
- 14,712
- Mol. weight
- 239.52 kDa
- Ligands
- B81
- Released
- 19 Nov 2025
Explore 9ECF in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9ECF contains 93 α-helices and 24 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-280 | 5 | |
| β-strand | 283 | 1 | 4 |
| α-helix | 291-315 | 25 | |
| α-helix | 319-321 | 3 | |
| α-helix | 324-346 | 23 | |
| β-strand | 353-357 | 5 | 5 |
| β-strand | 359 | 1 | 4 |
| β-strand | 360-363 | 4 | 5 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 423-442 | 20 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-495 | 7 | |
Chain B: 10 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-279 | 4 | |
| α-helix | 291-315 | 25 | |
| α-helix | 324-346 | 23 | |
| β-strand | 353-357 | 5 | 6 |
| β-strand | 360-363 | 4 | 6 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 421-443 | 23 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-496 | 8 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-10 | 7 | |
Chains D, G, H and L: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-9 | 7 | |
Chain E: 11 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-280 | 5 | |
| β-strand | 283 | 1 | 1 |
| α-helix | 288-289 | 2 | |
| α-helix | 291-314 | 24 | |
| α-helix | 324-346 | 23 | |
| β-strand | 353-357 | 5 | 2 |
| β-strand | 359 | 1 | 1 |
| β-strand | 360-363 | 4 | 2 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 420-442 | 23 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-495 | 7 | |
Chain F: 10 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-279 | 4 | |
| α-helix | 291-314 | 24 | |
| α-helix | 324-346 | 23 | |
| β-strand | 353-357 | 5 | 3 |
| β-strand | 360-363 | 4 | 3 |
| α-helix | 365-369 | 5 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-407 | 14 | |
| α-helix | 425-442 | 18 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-495 | 7 | |
Chain I: 11 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-280 | 5 | |
| α-helix | 288-289 | 2 | |
| α-helix | 291-314 | 24 | |
| α-helix | 324-346 | 23 | |
| β-strand | 353-357 | 5 | 7 |
| β-strand | 360-363 | 4 | 7 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 426-442 | 17 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-495 | 7 | |
Chain J: 10 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-271 | 7 | |
| α-helix | 276-280 | 5 | |
| β-strand | 283 | 1 | 8 |
| α-helix | 291-313 | 23 | |
| α-helix | 324-346 | 23 | |
| β-strand | 353-357 | 5 | 9 |
| β-strand | 359 | 1 | 8 |
| β-strand | 360-363 | 4 | 9 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 428-441 | 14 | |
| α-helix | 454-481 | 28 | |
| α-helix | 489-494 | 6 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Estrogen receptor beta | A, B, E, F, I, J, M, N | protein | 247 | Homo sapiens | Q92731 (AlphaFold model) |
| Nuclear receptor coactivator 2 | C, D, G, H, K, L, O, P | protein | 13 | Homo sapiens | Q15596 (AlphaFold model) |
Sequence of entity 1 (A, B, E, F, I, J, M, N), FASTA
>9ECF_1 Estrogen receptor beta (chains A, B, E, F, I, J, M, N)
MHHHHHHDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWA
KKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGI
LEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAV
TDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLE
MLNAHVL
Sequence of entity 2 (C, D, G, H, K, L, O, P), FASTA
>9ECF_2 Nuclear receptor coactivator 2 (chains C, D, G, H, K, L, O, P)
KHKILHRLLQDSS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| B81 | (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol | C19 H30 O2 | 8 |
Primary citation
Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide. Pederick, J.L., Bruning, J.B. To be published.
Other PDB entries of the same protein (UniProt Q92731 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3OLL 1.5 Å, Crystal structure of phosphorylated estrogen receptor beta ligand binding domain
- 7XVY 1.54 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with S-DPN
- 1QKM 1.8 Å, Human oestrogen receptor beta ligand-binding domain in complex with partial agonist…
- 7XWQ 1.89 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
- 7XWP 1.92 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
- 2YJD 1.93 Å, Stapled peptide bound to Estrogen Receptor Beta
- 3OMQ 1.97 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
- 1YYE 2.03 Å, Crystal structure of estrogen receptor beta complexed with way-202196
- 3OMP 2.05 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
- 7XVZ 2.08 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
- 2NV7 2.1 Å, Crystal Structure of Estrogen Receptor Beta Complexed with WAY-555
- 4J24 2.1 Å, Estrogen Receptor in complex with proline-flanked LXXLL peptides
Browse structure collections
About this viewer
MolViewer shows 9ECF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.