Structure of the DEAD domain of Human eukaryotic initiation factor 4A, eIF4A. Determined by X-ray diffraction at 2.25 Å resolution. Released 14 Mar 2006.
Explore 2G9N in 3D Show helices and sheets RCSB PDB PDBe
2G9N contains 21 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 34-36 | 3 | |
| α-helix | 41-50 | 10 | |
| α-helix | 57-68 | 12 | |
| β-strand | 72-75 | 4 | 1 |
| α-helix | 82-93 | 12 | |
| β-strand | 103-106 | 4 | 1 |
| α-helix | 110-124 | 15 | |
| β-strand | 131-134 | 4 | 1 |
| α-helix | 150-152 | 3 | |
| β-strand | 154-157 | 4 | 1 |
| α-helix | 159-167 | 9 | |
| β-strand | 178-182 | 5 | 1 |
| α-helix | 184-189 | 6 | |
| α-helix | 193-202 | 10 | |
| β-strand | 208-213 | 6 | 1 |
| α-helix | 218-227 | 10 | |
| β-strand | 232-235 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 34-36 | 3 | |
| α-helix | 41-50 | 10 | |
| α-helix | 57-68 | 12 | |
| β-strand | 72-75 | 4 | 2 |
| α-helix | 82-93 | 12 | |
| β-strand | 103-106 | 4 | 2 |
| α-helix | 110-123 | 14 | |
| β-strand | 131-134 | 4 | 2 |
| α-helix | 141-148 | 8 | |
| β-strand | 154-157 | 4 | 2 |
| α-helix | 159-167 | 9 | |
| β-strand | 178-182 | 5 | 2 |
| α-helix | 184-189 | 6 | |
| α-helix | 193-202 | 10 | |
| α-helix | 204 | 1 | |
| β-strand | 208-213 | 6 | 2 |
| α-helix | 218-227 | 10 | |
| β-strand | 232-235 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic initiation factor 4A-I | A, B | protein | 221 | Homo sapiens | P60842 (AlphaFold model) |
>2G9N_1 Eukaryotic initiation factor 4A-I (chains A, B) SMEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQ SGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGG TNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIY DIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKK
Comparative Structural Analysis of Human DEAD-Box RNA Helicases. Schutz, P., Karlberg, T., van den Berg, S. et al. PLoS One (2010) 5:12791-12791. DOI 10.1371/journal.pone.0012791 · PubMed
Other PDB entries of the same protein (UniProt P60842 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2G9N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.