2G9N: Eukaryotic initiation factor 4A-I

Structure of the DEAD domain of Human eukaryotic initiation factor 4A, eIF4A. Determined by X-ray diffraction at 2.25 Å resolution. Released 14 Mar 2006.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,657
Mol. weight: 50.17 kDa
Released: 14 Mar 2006

Explore 2G9N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G9N contains 21 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	34-36	3
α-helix	41-50	10
α-helix	57-68	12
β-strand	72-75	4	1
α-helix	82-93	12
β-strand	103-106	4	1
α-helix	110-124	15
β-strand	131-134	4	1
α-helix	150-152	3
β-strand	154-157	4	1
α-helix	159-167	9
β-strand	178-182	5	1
α-helix	184-189	6
α-helix	193-202	10
β-strand	208-213	6	1
α-helix	218-227	10
β-strand	232-235	4	1

Chain B: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	34-36	3
α-helix	41-50	10
α-helix	57-68	12
β-strand	72-75	4	2
α-helix	82-93	12
β-strand	103-106	4	2
α-helix	110-123	14
β-strand	131-134	4	2
α-helix	141-148	8
β-strand	154-157	4	2
α-helix	159-167	9
β-strand	178-182	5	2
α-helix	184-189	6
α-helix	193-202	10
α-helix	204	1
β-strand	208-213	6	2
α-helix	218-227	10
β-strand	232-235	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic initiation factor 4A-I	A, B	protein	221	Homo sapiens	P60842 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2G9N_1 Eukaryotic initiation factor 4A-I (chains A, B)
SMEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQ
SGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGG
TNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIY
DIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKK

Primary citation

Comparative Structural Analysis of Human DEAD-Box RNA Helicases. Schutz, P., Karlberg, T., van den Berg, S. et al. PLoS One (2010) 5:12791-12791. DOI 10.1371/journal.pone.0012791 · PubMed

Other PDB entries of the same protein (UniProt P60842 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZBZ 1.31 Å, Crystal structure of the DEAD domain of Human eIF4A with sanguinarine
9DTS 1.69 Å, Crystal structure of the human eIF4A1/AMPPNP/amidino-rocaglate/polypurine RNA complex
9I9G 1.7 Å, Crystal structure of human eIF4A1 C-terminal domain in complex with hippuristanol
9AVR 1.91 Å, Human eIF4A-1 in complex with AMP-PNP, RNA, and the inhibitor silvestrol
5ZC9 2.0 Å, Crystal structure of the human eIF4A1-ATP analog-RocA-polypurine RNA complex
7PPZ 2.52 Å, Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in…
9I9F 2.73 Å, Crystal structure of apoform human eIF4A1 C-terminal domain
2ZU6 2.8 Å, crystal structure of the eIF4A-PDCD4 complex
7PQ0 3.0 Å, Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in…
3EIQ 3.5 Å, Crystal structure of Pdcd4-eIF4A
8OZ0 3.5 Å, Structure of a human 48S translation initiation complex with eIF4F and eIF4A
8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4

Browse structure collections

About this viewer

MolViewer shows 2G9N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.