Structural and Functional insights into the human Upf1 helicase core. Determined by X-ray diffraction at 2.8 Å resolution. Released 9 Jan 2007.
Explore 2GK7 in 3D Show helices and sheets RCSB PDB PDBe
2GK7 contains 34 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 299-321 | 23 | |
| β-strand | 326 | 1 | 1 |
| β-strand | 330 | 1 | 2 |
| β-strand | 331 | 1 | 3 |
| β-strand | 345 | 1 | 3 |
| β-strand | 349 | 1 | 4 |
| β-strand | 361 | 1 | 5 |
| β-strand | 362-364 | 3 | 1 |
| β-strand | 376 | 1 | 1 |
| β-strand | 379-382 | 4 | 5 |
| β-strand | 391 | 1 | 3 |
| β-strand | 392-394 | 3 | 5 |
| β-strand | 408 | 1 | 2 |
| β-strand | 411-413 | 3 | 1 |
| α-helix | 418-432 | 15 | |
| β-strand | 437 | 1 | 6 |
| α-helix | 439-445 | 7 | |
| α-helix | 454-456 | 3 | |
| α-helix | 469-471 | 3 | |
| α-helix | 473-482 | 10 | |
| β-strand | 487-491 | 5 | 7 |
| α-helix | 498-511 | 14 | |
| α-helix | 516 | 1 | |
| β-strand | 517-521 | 5 | 7 |
| α-helix | 524-535 | 12 | |
| β-strand | 541-543 | 3 | 7 |
| α-helix | 547-549 | 3 | |
| α-helix | 557-559 | 3 | |
| β-strand | 560 | 1 | 7 |
| α-helix | 561-566 | 6 | |
| α-helix | 574-581 | 8 | |
| α-helix | 590-609 | 20 | |
| β-strand | 612-616 | 5 | 7 |
| α-helix | 618-621 | 4 | |
| α-helix | 623-625 | 3 | |
| β-strand | 632-635 | 4 | 7 |
| α-helix | 638-640 | 3 | |
| α-helix | 643-650 | 8 | |
| β-strand | 654 | 1 | 6 |
| β-strand | 656-661 | 6 | 7 |
| α-helix | 673-675 | 3 | |
| α-helix | 676-680 | 5 | |
| α-helix | 684-690 | 7 | |
| α-helix | 693-695 | 3 | |
| β-strand | 696-697 | 2 | 7 |
| α-helix | 698 | 1 | |
| β-strand | 700-701 | 2 | 8 |
| α-helix | 706-716 | 11 | |
| β-strand | 722-723 | 2 | 8 |
| α-helix | 728-730 | 3 | |
| β-strand | 746-750 | 5 | 9 |
| α-helix | 753-754 | 2 | |
| β-strand | 755-757 | 3 | 10 |
| β-strand | 761 | 1 | 4 |
| β-strand | 764-766 | 3 | 10 |
| α-helix | 767-783 | 17 | |
| α-helix | 787-789 | 3 | |
| β-strand | 790-793 | 4 | 9 |
| α-helix | 797-809 | 13 | |
| α-helix | 815-818 | 4 | |
| β-strand | 822-824 | 3 | 9 |
| α-helix | 827-829 | 3 | |
| β-strand | 834-840 | 7 | 9 |
| α-helix | 856-863 | 8 | |
| β-strand | 866-874 | 9 | 9 |
| α-helix | 876-879 | 4 | |
| α-helix | 883-894 | 12 | |
| β-strand | 899 | 1 | 9 |
| β-strand | 900 | 1 | 11 |
| β-strand | 905 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Regulator of nonsense transcripts 1 | A | protein | 624 | Homo sapiens | Q92900 (AlphaFold model) |
>2GK7_1 Regulator of nonsense transcripts 1 (chains A) PLGSRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKT DSDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQ VDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPD LNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQL TEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSA DEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPV VLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSA FPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEA ANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQ GREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLN YYKEQKVLVEGPLNNLRESLMQFS
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
Structural and functional insights into the human Upf1 helicase core. Cheng, Z., Muhlrad, D., Lim, M.K. et al. EMBO J (2007) 26:253-264. DOI 10.1038/sj.emboj.7601464 · PubMed
Other PDB entries of the same protein (UniProt Q92900 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2GK7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.