Crystal structure of the complex between human nonsense mediated decay factors UPF1 and UPF2 Orthorhombic form. Determined by X-ray diffraction at 2.5 Å resolution. Released 7 Jul 2009.
Explore 2WJY in 3D Show helices and sheets RCSB PDB PDBe
2WJY contains 43 α-helices and 41 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 131-133 | 3 | |
| β-strand | 134-137 | 4 | 1 |
| β-strand | 142-145 | 4 | 1 |
| α-helix | 155-163 | 9 | |
| β-strand | 168-170 | 3 | 1 |
| β-strand | 180 | 1 | 1 |
| β-strand | 195-197 | 3 | 2 |
| β-strand | 206-207 | 2 | 2 |
| β-strand | 230-231 | 2 | 2 |
| β-strand | 233 | 1 | 3 |
| β-strand | 238 | 1 | 3 |
| α-helix | 244-247 | 4 | |
| α-helix | 248-253 | 6 | |
| α-helix | 259-269 | 11 | |
| α-helix | 289-292 | 4 | |
| α-helix | 299-323 | 25 | |
| β-strand | 326-329 | 4 | 4 |
| β-strand | 332-335 | 4 | 4 |
| β-strand | 341-345 | 5 | 4 |
| β-strand | 349 | 1 | 5 |
| β-strand | 361-366 | 6 | 4 |
| β-strand | 374-382 | 9 | 4 |
| β-strand | 385 | 1 | 6 |
| β-strand | 388 | 1 | 6 |
| β-strand | 391-395 | 5 | 4 |
| β-strand | 409-413 | 5 | 4 |
| α-helix | 418-432 | 15 | |
| β-strand | 437 | 1 | 7 |
| α-helix | 439-445 | 7 | |
| α-helix | 454-456 | 3 | |
| α-helix | 465 | 1 | |
| α-helix | 469-471 | 3 | |
| α-helix | 473-483 | 11 | |
| β-strand | 487-491 | 5 | 8 |
| α-helix | 498-510 | 13 | |
| α-helix | 516 | 1 | |
| β-strand | 517-521 | 5 | 8 |
| α-helix | 524-535 | 12 | |
| β-strand | 541-543 | 3 | 8 |
| α-helix | 547-551 | 5 | |
| α-helix | 557-559 | 3 | |
| β-strand | 560 | 1 | 8 |
| α-helix | 561-566 | 6 | |
| α-helix | 572-581 | 10 | |
| α-helix | 589-609 | 21 | |
| β-strand | 612-616 | 5 | 8 |
| α-helix | 618-621 | 4 | |
| β-strand | 632-635 | 4 | 8 |
| α-helix | 638-640 | 3 | |
| α-helix | 643-650 | 8 | |
| β-strand | 654 | 1 | 7 |
| β-strand | 656-661 | 6 | 8 |
| α-helix | 673-675 | 3 | |
| α-helix | 676-680 | 5 | |
| α-helix | 684-690 | 7 | |
| α-helix | 693-695 | 3 | |
| β-strand | 696-697 | 2 | 8 |
| α-helix | 698 | 1 | |
| β-strand | 700-701 | 2 | 9 |
| α-helix | 706-716 | 11 | |
| α-helix | 721 | 1 | |
| β-strand | 722-723 | 2 | 9 |
| α-helix | 728-730 | 3 | |
| β-strand | 746-750 | 5 | 10 |
| α-helix | 753-755 | 3 | |
| β-strand | 756-757 | 2 | 11 |
| β-strand | 761 | 1 | 5 |
| β-strand | 764-765 | 2 | 11 |
| α-helix | 767-782 | 16 | |
| α-helix | 787-789 | 3 | |
| β-strand | 790-793 | 4 | 10 |
| α-helix | 797-810 | 14 | |
| α-helix | 815-819 | 5 | |
| β-strand | 822-824 | 3 | 10 |
| α-helix | 826-829 | 4 | |
| β-strand | 834-840 | 7 | 10 |
| α-helix | 851-853 | 3 | |
| α-helix | 856-863 | 8 | |
| β-strand | 866-874 | 9 | 10 |
| α-helix | 876-879 | 4 | |
| α-helix | 885-894 | 10 | |
| β-strand | 898-900 | 3 | 10 |
| α-helix | 903-905 | 3 | |
| β-strand | 907-908 | 2 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Regulator of nonsense transcripts 1 | A | protein | 800 | HOMO SAPIENS | Q92900 (AlphaFold model) |
>2WJY_1 REGULATOR OF NONSENSE TRANSCRIPTS 1 (chains A) TKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDG PLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQ DRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLL RYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDM RLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFV WKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHS QVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKI HQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKR YRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGA KQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSN IFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVE KITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREK DFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKE QKVLVEGPLNNLRESLMQFS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (SO4) are not listed.
Unusual Bipartite Mode of Interaction between the Nonsense-Mediated Decay Factors, Upf1 and Upf2. Clerici, M., Mourao, A., Gutsche, I. et al. EMBO J (2009) 28:2293. DOI 10.1038/EMBOJ.2009.175 · PubMed
Other PDB entries of the same protein (UniProt Q92900 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2WJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.