A conserved structural element in the RNA helicase UPF1 regulates its catalytic activity in an isoform-specific manner. Determined by X-ray diffraction at 3.34 Å resolution. Released 24 Jan 2018.
Explore 6EJ5 in 3D Show helices and sheets RCSB PDB PDBe
6EJ5 contains 25 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 299-322 | 24 | |
| β-strand | 325 | 1 | 1 |
| β-strand | 329 | 1 | 1 |
| β-strand | 331-334 | 4 | 1 |
| β-strand | 342-345 | 4 | 1 |
| β-strand | 372-377 | 6 | 1 |
| β-strand | 385-391 | 7 | 1 |
| β-strand | 403-407 | 5 | 1 |
| β-strand | 420-424 | 5 | 1 |
| α-helix | 429-442 | 14 | |
| β-strand | 448 | 1 | 2 |
| α-helix | 450-456 | 7 | |
| α-helix | 461-463 | 3 | |
| α-helix | 476 | 1 | |
| α-helix | 480-483 | 4 | |
| α-helix | 484-494 | 11 | |
| β-strand | 498-502 | 5 | 3 |
| α-helix | 509-522 | 14 | |
| β-strand | 529-532 | 4 | 3 |
| α-helix | 537-546 | 10 | |
| β-strand | 552-554 | 3 | 3 |
| β-strand | 571 | 1 | 3 |
| α-helix | 572-575 | 4 | |
| α-helix | 583-591 | 9 | |
| α-helix | 600-618 | 19 | |
| β-strand | 623-627 | 5 | 3 |
| β-strand | 643-646 | 4 | 3 |
| α-helix | 649-651 | 3 | |
| β-strand | 653 | 1 | 4 |
| α-helix | 654-661 | 8 | |
| β-strand | 665 | 1 | 2 |
| β-strand | 667-672 | 6 | 3 |
| α-helix | 684-686 | 3 | |
| α-helix | 687-691 | 5 | |
| β-strand | 694 | 1 | 4 |
| α-helix | 695-702 | 8 | |
| β-strand | 707-708 | 2 | 3 |
| β-strand | 711 | 1 | 5 |
| α-helix | 721-727 | 7 | |
| β-strand | 733 | 1 | 5 |
| β-strand | 757-761 | 5 | 6 |
| β-strand | 766-767 | 2 | 7 |
| β-strand | 776-777 | 2 | 7 |
| α-helix | 778-790 | 13 | |
| α-helix | 798-800 | 3 | |
| β-strand | 801-804 | 4 | 6 |
| α-helix | 808-817 | 10 | |
| β-strand | 833-835 | 3 | 6 |
| α-helix | 837-839 | 3 | |
| β-strand | 845-851 | 7 | 6 |
| α-helix | 867-874 | 8 | |
| β-strand | 877-885 | 9 | 6 |
| α-helix | 887-890 | 4 | |
| α-helix | 894-905 | 12 | |
| β-strand | 910-911 | 2 | 8 |
| β-strand | 918-919 | 2 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Regulator of nonsense transcripts 1 | A | protein | 637 | Homo sapiens | Q92900 (AlphaFold model) |
>6EJ5_1 Regulator of nonsense transcripts 1 (chains A) GAADSMRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLP KTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRS SVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKC QLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPV LVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKL QQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDE STQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR LQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEI ASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKL YQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPK ALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFS
A conserved structural element in the RNA helicase UPF1 regulates its catalytic activity in an isoform-specific manner. Gowravaram, M., Bonneau, F., Kanaan, J. et al. Nucleic Acids Res (2018) 46:2648-2659. DOI 10.1093/nar/gky040 · PubMed
Other PDB entries of the same protein (UniProt Q92900 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6EJ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.