2GX9: Influenza virus NS1 effector domain

X-ray structure of influenza virus NS1 effector domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 30 May 2006.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: unidentified influenza virus
Chains: 2
Atoms: 2,229
Mol. weight: 29.65 kDa
Ligands: SCN
Released: 30 May 2006

Explore 2GX9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GX9 contains 7 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	84-87	4
β-strand	88-91	4	1
α-helix	95-99	5
β-strand	107-112	6	1
β-strand	115-120	6	1
β-strand	127-137	11	1
β-strand	140-151	12	1
β-strand	156-162	7	1
α-helix	171-186	16
β-strand	191-194	4	1
α-helix	196-201	6

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	88-91	4	1
α-helix	95-99	5
β-strand	107-112	6	1
β-strand	115-120	6	1
β-strand	127-137	11	1
β-strand	140-151	12	1
β-strand	156-162	7	1
α-helix	171-187	17
β-strand	191-194	4	1
α-helix	196-205	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NS1 Effector Domain	A, B	protein	129	unidentified influenza virus	P03496 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2GX9_1 NS1 Effector Domain (chains A, B)
MTMASVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIF
DRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETL
QRFAWRSSN

Ligands and cofactors

ID	Name	Formula	Copies
SCN	Thiocyanate ion	C N S	3

Primary citation

X-ray structure of influenza virus NS1 effector domain. Bornholdt, Z.A., Prasad, B.V. Nat Struct Mol Biol (2006) 13:559-560. DOI 10.1038/nsmb1099 · PubMed

Other PDB entries of the same protein (UniProt P03496 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZKO 1.7 Å, Structural basis for dsRNA recognition by NS1 protein of human influenza virus A
3RVC 1.8 Å, Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation
3O9R 2.0 Å, Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation
3O9T 2.2 Å, Effector domain from influenza A/PR/8/34 NS1
3L4Q 2.3 Å, Structural insights into phosphoinositide 3-kinase activation by the influenza A virus…
3O9S 2.48 Å, Effector domain of influenza A/PR/8/34 NS1
3O9Q 2.5 Å, Effector domain of NS1 from A/PR/8/34 containing a W187A mutation
5NT1 2.82 Å, Complex of influenza A NS1 effector domain with TRIM25 coiled coil
3O9U 3.2 Å, Effector domain of influenza A/PR/8/34 NS1
5NT2 4.26 Å, Complex of influenza A NS1 with TRIM25 coiled coil domain

Browse structure collections

About this viewer

MolViewer shows 2GX9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.