2ZKO: Non-structural protein 1

Structural basis for dsRNA recognition by NS1 protein of human influenza virus A. Determined by X-ray diffraction at 1.7 Å resolution. Released 14 Oct 2008.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Influenza A virus
Chains: 4
Atoms: 2,225
Mol. weight: 30.11 kDa
Released: 14 Oct 2008

Explore 2ZKO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZKO contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-24	22
α-helix	30-50	21
α-helix	54-69	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA (5'-r(papgpapcpapgpcpapupupapupgpcpupgpupcpupup*u)-3')	C, D	RNA	21
Non-structural protein 1	A, B	protein	73	Influenza A virus	P03496 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>2ZKO_1 RNA (5'-R(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*UP*CP*UP*UP*U)-3') (chains C, D)
AGACAGCAUUAUGCUGUCUUU

Sequence of entity 2 (A, B), FASTA

>2ZKO_2 Non-structural protein 1 (chains A, B)
GSHMDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETA
TRAGKQIVERILK

Primary citation

Structural basis for dsRNA recognition by NS1 protein of influenza A virus. Cheng, A., Wong, S.M., Yuan, Y.A. Cell Res (2009) 19:187-195. DOI 10.1038/cr.2008.288 · PubMed

Other PDB entries of the same protein (UniProt P03496 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RVC 1.8 Å, Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation
3O9R 2.0 Å, Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation
2GX9 2.1 Å, X-ray structure of influenza virus NS1 effector domain
3O9T 2.2 Å, Effector domain from influenza A/PR/8/34 NS1
3L4Q 2.3 Å, Structural insights into phosphoinositide 3-kinase activation by the influenza A virus…
3O9S 2.48 Å, Effector domain of influenza A/PR/8/34 NS1
3O9Q 2.5 Å, Effector domain of NS1 from A/PR/8/34 containing a W187A mutation
5NT1 2.82 Å, Complex of influenza A NS1 effector domain with TRIM25 coiled coil
3O9U 3.2 Å, Effector domain of influenza A/PR/8/34 NS1
5NT2 4.26 Å, Complex of influenza A NS1 with TRIM25 coiled coil domain

Browse structure collections

About this viewer

MolViewer shows 2ZKO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.