3O9U: Effector domain of influenza A/PR/8/34 NS1

Effector domain of influenza A/PR/8/34 NS1. Determined by X-ray diffraction at 3.2 Å resolution. Released 11 May 2011.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Influenza A virus
Chains: 8
Atoms: 7,247
Mol. weight: 135.93 kDa
Released: 11 May 2011

Explore 3O9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O9U contains 24 α-helices and 50 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, D, E, F and H: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	95-99	5
β-strand	109-111	3	2
β-strand	115-119	5	2
β-strand	127-137	11	2
β-strand	140-150	11	2
β-strand	156-162	7	2
α-helix	171-186	16
β-strand	191-194	4	2
α-helix	196-200	5

Chains C and G: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	89	1	3
α-helix	95-99	5
β-strand	109-111	3	4
β-strand	115-119	5	4
β-strand	127-137	11	4
β-strand	140-150	11	4
β-strand	156-162	7	4
α-helix	171-186	16
β-strand	191-194	4	4
α-helix	196-200	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nonstructural protein 1	A, B, C, D, E, F, G, H	protein	152	Influenza A virus	P03496 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>3O9U_1 Nonstructural protein 1 (chains A, B, C, D, E, F, G, H)
MTMASVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIF
DRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETL
QRFAWRSSNENGRPPLTPKQKREMAGTIRSEV

Primary citation

A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain. Kerry, P.S., Ayllon, J., Taylor, M.A. et al. PLoS One (2011) 6:e17946-e17946. DOI 10.1371/journal.pone.0017946 · PubMed

Other PDB entries of the same protein (UniProt P03496 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZKO 1.7 Å, Structural basis for dsRNA recognition by NS1 protein of human influenza virus A
3RVC 1.8 Å, Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation
3O9R 2.0 Å, Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation
2GX9 2.1 Å, X-ray structure of influenza virus NS1 effector domain
3O9T 2.2 Å, Effector domain from influenza A/PR/8/34 NS1
3L4Q 2.3 Å, Structural insights into phosphoinositide 3-kinase activation by the influenza A virus…
3O9S 2.48 Å, Effector domain of influenza A/PR/8/34 NS1
3O9Q 2.5 Å, Effector domain of NS1 from A/PR/8/34 containing a W187A mutation
5NT1 2.82 Å, Complex of influenza A NS1 effector domain with TRIM25 coiled coil
5NT2 4.26 Å, Complex of influenza A NS1 with TRIM25 coiled coil domain

Browse structure collections

About this viewer

MolViewer shows 3O9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.