2H7B: Core-binding factor, ML1-ETO

Solution structure of the eTAFH domain from the human leukemia-associated fusion protein AML1-ETO. Determined by solution NMR. Released 11 Jul 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 839
Mol. weight: 11.89 kDa
Released: 11 Jul 2006

Explore 2H7B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2H7B contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	6-16	11
α-helix	18-21	4
α-helix	23-37	15
α-helix	43-53	11
α-helix	63-67	5
α-helix	70-80	11
α-helix	81-83	3
α-helix	90-93	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Core-binding factor, ML1-ETO	A	protein	105	Homo sapiens	Q06455 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2H7B_1 Core-binding factor, ML1-ETO (chains A)
GSARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPL
RPFVIPFLKANLPLLQRELLHAARLAKQNPAQYLAQHEQLLLDAS

Primary citation

The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain. Plevin, M.J., Zhang, J., Guo, C. et al. Proc Natl Acad Sci U S A (2006) 103:10242-10247. DOI 10.1073/pnas.0603463103 · PubMed

Other PDB entries of the same protein (UniProt Q06455 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WQ6 2.0 Å, The tetramer structure of the nervy homolgy two (NHR2) domain of AML1-ETO is critical…
4JOL 2.91 Å, Complex structure of AML1-ETO NHR2 domain with HEB fragment
2DJ8 Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8)
2KNH The Solution structure of the eTAFH domain of AML1-ETO complexed with HEB peptide
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
2OD1 Solution structure of the MYND domain from human AML1-ETO
2ODD Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor
2PP4 Solution Structure of ETO-TAFH refined in explicit solvent

Browse structure collections

About this viewer

MolViewer shows 2H7B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.