2H7E: Talin F3 domain

Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP kinase peptide- minimized average structure. Determined by solution NMR. Released 30 Jan 2007.

Method: Solution NMR
Organism: Gallus gallus
Chains: 2
Atoms: 1,110
Mol. weight: 15.76 kDa
Released: 30 Jan 2007

Explore 2H7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2H7E contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	311-318	8	1
α-helix	319	1
β-strand	325-332	8	1
β-strand	336-340	5	1
β-strand	347-352	6	1
β-strand	356-361	6	1
β-strand	365-370	6	1
β-strand	378-382	5	1
α-helix	385-402	18

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	723-735	13
β-strand	739-741	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A	protein	101	Gallus gallus	P54939 (AlphaFold model)
Chimera of 24-mer peptide from Integrin beta-3 and 10-mer peptide from…	B	protein	34		O70161 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2H7E_1 Talin-1 (chains A)
PLGSGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPK
SFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS

Sequence of entity 2 (B), FASTA

>2H7E_2 Chimera of 24-mer peptide from Integrin beta-3 and 10-mer peptide from Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma (chains B)
KLLITIHDRKEFAKFEEERARAKWVYSPLHYSAR

Primary citation

Structural basis of integrin activation by talin. Wegener, K.L., Partridge, A.W., Han, J. et al. Cell (2007) 128:171-182. DOI 10.1016/j.cell.2006.10.048 · PubMed

Other PDB entries of the same protein (UniProt P54939 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MIX 1.75 Å, Crystal structure of a FERM domain of Talin
1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1MIZ 1.9 Å, Crystal structure of an integrin beta3-talin chimera
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
1MK7 2.2 Å, Crystal structure of an integrin BETA3-talin chimera
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
1XWJ 2.6 Å, Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
1RKC 2.7 Å, Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues…
8S4Y 2.7 Å, Crystal structure of an APP-talin (F2F3) chimera
1MK9 2.8 Å, Crystal structure of an integrin BETA3-talin chimera
2H7D Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…
2HRJ NMR solution structure of the F2 subdomain of talin

Browse structure collections

About this viewer

MolViewer shows 2H7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.