2HBP: Sla1 Homology Domain 1

Solution Structure of Sla1 Homology Domain 1. Determined by solution NMR. Released 10 Apr 2007.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 515
Mol. weight: 7.45 kDa
Released: 10 Apr 2007

Explore 2HBP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HBP contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	1
β-strand	10	1	2
β-strand	16-19	4	1
β-strand	20-25	6	3
β-strand	28-32	5	3
β-strand	38-42	5	3
β-strand	46	1	2
α-helix	48-58	11
α-helix	63-65	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoskeleton assembly control protein SLA1	A	protein	68	Saccharomyces cerevisiae	P32790 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HBP_1 Cytoskeleton assembly control protein SLA1 (chains A)
GSKKSRLWVDRSGTFKVDAEFIGCAKGKIHLHKANGVKIAVAADKLSNEDLAYVEKITGF
SLEKFKAN

Primary citation

Structure of Sla1p homology domain 1 and interaction with the NPFxD endocytic internalization motif. Mahadev, R.K., Di Pietro, S.M., Olson, J.M. et al. EMBO J (2007) 26:1963-1971. DOI 10.1038/sj.emboj.7601646 · PubMed

Other PDB entries of the same protein (UniProt P32790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V1Q 1.2 Å, Atomic-resolution structure of the yeast Sla1 SH3 domain 3
1SSH 1.4 Å, Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein…
9HDB 1.49 Å, Sla1 SH3_3 domain (residues 355-414)
3IDW 1.85 Å, Crystal structure of Sla1 homology domain 2
1Z9Z 1.95 Å, Crystal structure of yeast sla1 SH3 domain 3
2JT4 Solution Structure of the Sla1 SH3-3-Ubiquitin Complex

Browse structure collections

About this viewer

MolViewer shows 2HBP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.