2HD7: C-teminal domain of twinfilin-1

Solution structure of C-teminal domain of twinfilin-1. Determined by solution NMR. Released 6 Feb 2007.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,170
Mol. weight: 16.64 kDa
Released: 6 Feb 2007

Explore 2HD7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HD7 contains 7 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	181	1
β-strand	182	1	1
α-helix	183	1
α-helix	184-193	10
β-strand	200-206	7	1
β-strand	211-216	6	1
α-helix	225-227	3
β-strand	235-245	11	1
β-strand	248-258	11	1
α-helix	266-281	16
α-helix	282-286	5
β-strand	291-297	7	1
α-helix	305-312	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Twinfilin-1	A	protein	142	Mus musculus	Q91YR1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HD7_1 Twinfilin-1 (chains A)
AQGVAFPISRDAFQALEKLSKKQLNYVQLEIDIKNETIILANTENTELRDLPKRIPKDSA
RYHFFLYKHSHEGDYLESVVFIYSMPGYTCSIRERMLYSSCKSPLLEIVERQLQMDVIRK
IEIDNGDELTADFLYDEVHPKQ

Primary citation

Structural basis and evolutionary origin of actin filament capping by twinfilin. Paavilainen, V.O., Hellman, M., Helfer, E. et al. Proc Natl Acad Sci U S A (2007) 104:3113-3118. DOI 10.1073/pnas.0608725104 · PubMed

Other PDB entries of the same protein (UniProt Q91YR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1M4J 1.6 Å, Crystal structure of the N-terminal adf-H domain of mouse twinfilin isoform-1
7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
6RSW 1.95 Å, HFD domain of mouse CAP1 bound to the pointed end of G-actin
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
7DSB 2.44 Å, Crystal structure of actin capping protein in complex with V-1 and twinfilin C-terminal…
3DAW 2.55 Å, Structure of the actin-depolymerizing factor homology domain in complex with actin
6YP9 2.56 Å, Rabbit muscle actin in complex with ADF-H and ATP-ATTO-488
2D8B Solution structure of the second tandem cofilin-domain of mouse twinfilin

Browse structure collections

About this viewer

MolViewer shows 2HD7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.