Solution structure of V21C/V59C Lymphotactin/XCL1. Determined by solution NMR. Released 1 May 2007.
Explore 2HDM in 3D Show helices and sheets RCSB PDB PDBe
2HDM contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15 | 1 | 1 |
| α-helix | 21-23 | 3 | |
| β-strand | 24-30 | 7 | 1 |
| β-strand | 36-41 | 6 | 1 |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 54-66 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lymphotactin | A | protein | 92 | Homo sapiens | P47992 (AlphaFold model) |
>2HDM_1 Lymphotactin (chains A) GSEVSDKRTCVSLTTQRLPCSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDCVR SMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
An engineered second disulfide bond restricts lymphotactin/XCL1 to a chemokine-like conformation with XCR1 agonist activity. Tuinstra, R.L., Peterson, F.C., Elgin, E.S. et al. Biochemistry (2007) 46:2564-2573. DOI 10.1021/bi602365d · PubMed
Other PDB entries of the same protein (UniProt P47992 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2HDM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.