2HDM: V21C/V59C Lymphotactin/XCL1

Solution structure of V21C/V59C Lymphotactin/XCL1. Determined by solution NMR. Released 1 May 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 582
Mol. weight: 10.2 kDa
Released: 1 May 2007

Explore 2HDM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HDM contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	21-23	3
β-strand	24-30	7	1
β-strand	36-41	6	1
β-strand	46-49	4	1
α-helix	54-66	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lymphotactin	A	protein	92	Homo sapiens	P47992 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HDM_1 Lymphotactin (chains A)
GSEVSDKRTCVSLTTQRLPCSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDCVR
SMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Primary citation

An engineered second disulfide bond restricts lymphotactin/XCL1 to a chemokine-like conformation with XCR1 agonist activity. Tuinstra, R.L., Peterson, F.C., Elgin, E.S. et al. Biochemistry (2007) 46:2564-2573. DOI 10.1021/bi602365d · PubMed

Other PDB entries of the same protein (UniProt P47992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NYZ 2.6 Å, Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The C-…
9AST 3.07 Å, Cryo-EM structure of XCR1 signaling complex
1J8I Solution Structure of Human Lymphotactin
1J9O Solution structure of human lymphotactin
2JP1 Solution structure of the alternative conformation of XCL1/Lymphotactin
2N54 Solution structure of a disulfide stabilized XCL1 dimer

Browse structure collections

About this viewer

MolViewer shows 2HDM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.