2HL5: C-terminal domain of human EB1

Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued). Determined by X-ray diffraction at 1.93 Å resolution. Released 12 Sept 2006.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,272
Mol. weight: 39.2 kDa
Released: 12 Sept 2006

Explore 2HL5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HL5 contains 8 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	195-230	36
α-helix	232-234	3
α-helix	237-247	11

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	197-230	34
α-helix	232-234	3
α-helix	237-247	11

Chains C and D: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	32-35	4	1
β-strand	41-48	8	1
β-strand	57-62	6	1
β-strand	69	1	1
β-strand	72-73	2	2
β-strand	76-77	2	2
β-strand	86-89	4	1
α-helix	91-93	3
β-strand	94-96	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein RP/EB family member 1	A, B	protein	80	Homo sapiens	Q15691 (AlphaFold model)
Dynactin-1	C, D	protein	97	Homo sapiens	Q14203 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2HL5_1 Microtubule-associated protein RP/EB family member 1 (chains A, B)
GSDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYA
TDEGFVIPDEGGPQEEQEEY

Sequence of entity 2 (C, D), FASTA

>2HL5_2 Dynactin-1 (chains C, D)
GSHMSAEASARPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQ
GRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDS

Primary citation

Key interaction modes of dynamic +TIP networks. Honnappa, S., Okhrimenko, O., Jaussi, R. et al. Mol Cell (2006) 23:663-671. DOI 10.1016/j.molcel.2006.07.013 · PubMed

Other PDB entries of the same protein (UniProt Q15691 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QJZ 1.25 Å, Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
2R8U 1.35 Å, Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal…
1PA7 1.45 Å, Crystal structure of amino-terminal microtubule binding domain of EB1
1WU9 1.54 Å, Crystal structure of the C-terminal domain of the end-binding protein 1 (EB1)
5JVM 1.57 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3C
1VKA 1.6 Å, Southeast Collaboratory for Structural Genomics: Hypothetical Human Protein Q15691…
5JX1 1.67 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1
1TXQ 1.8 Å, Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of…
1YIB 1.8 Å, Crystal Structure of the Human EB1 C-terminal Dimerization Domain
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
2HKQ 1.86 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly…
5JVU 1.95 Å, The neck-linker and alpha 7 helix of Drosophila melanogaster kinesin-1 fused to EB1

Browse structure collections

About this viewer

MolViewer shows 2HL5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.