2HM8: C-terminal MA-3 domain of Pdcd4

Solution Structure of the C-terminal MA-3 domain of Pdcd4. Determined by solution NMR. Released 20 Feb 2007.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,086
Mol. weight: 15.5 kDa
Released: 20 Feb 2007

Explore 2HM8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HM8 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	326-341	16
α-helix	344-353	10
α-helix	357-373	17
α-helix	377-392	16
α-helix	398-408	11
α-helix	422-436	15
α-helix	441-446	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pdcd4 C-terminal MA-3 domain	A	protein	136	Mus musculus	Q61823 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HM8_1 Pdcd4 C-terminal MA-3 domain (chains A)
GPLGSGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLE
STGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEEC
FQAGIISKQLRDLCPS

Primary citation

Structure of the C-terminal MA-3 domain of the tumour suppressor protein Pdcd4 and characterization of its interaction with eIF4A. Waters, L.C., Veverka, V., Bohm, M. et al. Oncogene (2007) 26:4941-4950. DOI 10.1038/sj.onc.1210305 · PubMed

Other PDB entries of the same protein (UniProt Q61823 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NSZ 1.15 Å, 1.15 Angstrom Crystal Structure of the MA3 domain of Pdcd4
2ION 1.57 Å, Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form2
2IOS 1.76 Å, Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 3
2IOL 2.0 Å, Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 1
3EIQ 3.5 Å, Crystal structure of Pdcd4-eIF4A
2KZT Structure of the Tandem MA-3 Region of Pdcd4

Browse structure collections

About this viewer

MolViewer shows 2HM8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.