2HQ6: Serologically defined colon cancer antigen 10

Name: PDB 2HQ6: Structure of the Cyclophilin_CeCYP16-Like Domain of the Serologically Defined Colon Cancer Antigen 10 from Homo Sapiens
Published: 2006-08-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Structure of the Cyclophilin_CeCYP16-Like Domain of the Serologically Defined Colon Cancer Antigen 10 from Homo Sapiens. Determined by X-ray diffraction at 1.75 Å resolution. Released 1 Aug 2006.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,516
Mol. weight: 20.92 kDa
Released: 1 Aug 2006

Explore 2HQ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HQ6 contains 5 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	7-11	5
β-strand	12	1	1
β-strand	14-19	6	2
β-strand	22-28	7	2
β-strand	29	1	1
α-helix	34-45	12
β-strand	52-53	2	2
β-strand	56-58	3	2
β-strand	62-65	4	2
β-strand	83	1	3
β-strand	88	1	4
β-strand	91	1	4
β-strand	98-101	4	2
β-strand	109	1	3
β-strand	113-116	4	2
α-helix	121-123	3
β-strand	129-133	5	2
α-helix	135-137	3
α-helix	138-143	6
β-strand	149	1	5
β-strand	155	1	5
β-strand	160-168	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serologically defined colon cancer antigen 10	A	protein	185	Homo sapiens	Q6UX04 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HQ6_1 Serologically defined colon cancer antigen 10 (chains A)
MGSSHHHHHHSSGLVPRGSEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAY
YDNTIFHRVVPGFIVQGGDPTGTGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHD
NGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHKIKSCEVLF
NPFDD

Primary citation

Structural and biochemical characterization of the human cyclophilin family of peptidyl-prolyl isomerases. Davis, T.L., Walker, J.R., Campagna-Slater, V. et al. PLoS Biol (2010) 8:e1000439-e1000439. DOI 10.1371/journal.pbio.1000439 · PubMed

Other PDB entries of the same protein (UniProt Q6UX04 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R3E 2.0 Å, Structure of the spliceosomal peptidyl-prolyl cis-trans isomerase Cwc27 from Homo sapiens
7DVQ 2.89 Å, Cryo-EM Structure of the Activated Human Minor Spliceosome (minor Bact Complex)
8I0R 3.0 Å, The cryo-EM structure of human Bact-I complex
6YVH 3.19 Å, CWC22-CWC27-EIF4A3 Complex
6FF4 3.4 Å, human Bact spliceosome core structure
6FF7 4.5 Å, human Bact spliceosome core structure
5Z58 4.9 Å, Cryo-EM structure of a human activated spliceosome (early Bact) at 4.9 angstrom.
5Z56 5.1 Å, cryo-EM structure of a human activated spliceosome (mature Bact) at 5.1 angstrom.

Browse structure collections

About this viewer

MolViewer shows 2HQ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.