2HY8: PAK1 complex with ST2001

PAK1 complex with ST2001. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Nov 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,437
Mol. weight: 33.78 kDa
Ligands: 1ST
Released: 7 Nov 2006

Explore 2HY8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HY8 contains 19 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 19 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	250-260	11
β-strand	262	1	1
α-helix	266-268	3
β-strand	270-279	10	1
β-strand	282-289	8	1
β-strand	295-302	8	1
α-helix	309-321	13
β-strand	327	1	2
α-helix	328-329	2
β-strand	330-336	7	1
β-strand	339-345	7	1
β-strand	351	1	2
α-helix	352-358	7
α-helix	363-382	20
β-strand	385-386	2	3
α-helix	392-394	3
β-strand	395-397	3	2
β-strand	403-405	3	2
β-strand	412-413	2	3
β-strand	415	1	4
β-strand	418	1	4
β-strand	421	1	5
α-helix	428-430	3
α-helix	434-437	4
β-strand	441	1	5
α-helix	444-459	16
α-helix	469-479	11
α-helix	487-489	3
α-helix	492-501	10
α-helix	510-511	2
α-helix	512-515	4
α-helix	519-523	5
α-helix	524-526	3
α-helix	527-530	4
α-helix	531-540	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase PAK 1	1	protein	297	Homo sapiens	Q13153 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>2HY8_1 Serine/threonine-protein kinase PAK 1 (chains 1)
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPK
KELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAA
VCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSEMVGTP
YWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPE
KLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH

Ligands and cofactors

ID	Name	Formula	Copies
1ST	(5S,6R,7R,9R)-12-hydroxy-6-methoxy-5-methyl-7-(methylamino)-6,7,8,9-tetrahydro-…	C28 H24 N4 O4	1

Primary citation

Crystal Structure of the Complex Between Human Pak1-kinase and 3-Hydroxystaurosporine. Lu, H., Lei, M., Schulze-Gahmen, U. To be published.

Other PDB entries of the same protein (UniProt Q13153 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FXZ 1.64 Å, Crystal structure of PAK1 kinase domain with ruthenium complex lambda-FL172
2QME 1.75 Å, Crystal structure of human RAC3 in complex with CRIB domain of human p21-activated…
9N4U 1.77 Å, Crystal structure of PAK1 bound to compound R1
1YHV 1.8 Å, Crystal Structure of PAK1 kinase domain with two point mutations (K299R, T423E)
1YHW 1.8 Å, Crystal Structure of PAK1 kinase domain with one point mutations (K299R)
8X5Z 1.8 Å, The Crystal Structure of PAK1 kinase domain from Biortus.
3Q52 1.8 Å, Structure of phosphorylated PAK1 kinase domain
9D4V 1.84 Å, Structure of PAK1 in complex with compound 7
9D4X 1.85 Å, Structure of PAK1 in complex with compound 16
9D4Y 1.85 Å, Structure of PAK1 in complex with compound 31
9N48 1.85 Å, Crystal structure of PAK1 bound to compound C1
3Q4Z 1.89 Å, Structure of unphosphorylated PAK1 kinase domain

Browse structure collections

About this viewer

MolViewer shows 2HY8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.