2HZM: Mediator head subcomplex Med18/20

Structure of the Mediator head subcomplex Med18/20. Determined by X-ray diffraction at 2.4 Å resolution. Released 12 Sept 2006.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Saccharomyces cerevisiae
Chains: 8
Atoms: 13,587
Mol. weight: 234.39 kDa
Ligands: PO4
Released: 12 Sept 2006

Explore 2HZM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HZM contains 68 α-helices and 82 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
α-helix	16-24	9
α-helix	25-27	3
β-strand	30-31	2	1
β-strand	35-44	10	1
β-strand	56-63	8	1
β-strand	67-73	7	1
β-strand	76-81	6	1
α-helix	84-86	3
α-helix	89-93	5
α-helix	104-111	8
β-strand	116-132	17	1
β-strand	135-144	10	1
β-strand	147-157	11	1
α-helix	160-162	3
α-helix	163-176	14
β-strand	183-185	3	1
α-helix	196-208	13

Chain B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	13-15	3
α-helix	16-27	12
β-strand	32-43	12	1
α-helix	45-47	3
β-strand	64-68	5	1
α-helix	72-74	3
α-helix	87-92	6
β-strand	164-170	7	1
β-strand	181-195	15	1
α-helix	200-206	7
β-strand	209-223	15	1
α-helix	225-227	3
β-strand	229-239	11	1
β-strand	242-245	4	1
β-strand	250-259	10	1
α-helix	265-281	17
β-strand	289	1	1
α-helix	293-297	5
α-helix	299-301	3
α-helix	305-312	8

Chain C: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	2
α-helix	16-23	8
α-helix	24-26	3
β-strand	28-31	4	2
β-strand	35-44	10	2
β-strand	56-63	8	2
β-strand	67-73	7	2
β-strand	76-81	6	2
α-helix	84-86	3
α-helix	89-93	5
α-helix	104-111	8
β-strand	116-132	17	2
β-strand	135-144	10	2
β-strand	147-156	10	2
α-helix	163-176	14
β-strand	183-185	3	2
α-helix	196-208	13

Chain D: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	2
α-helix	13-15	3
α-helix	16-27	12
β-strand	32-43	12	2
β-strand	64-68	5	2
α-helix	72-74	3
α-helix	87-90	4
β-strand	164-170	7	2
α-helix	173-175	3
β-strand	181-195	15	2
α-helix	200-207	8
β-strand	209-223	15	2
α-helix	225-227	3
β-strand	229-238	10	2
β-strand	243-245	3	2
β-strand	250-259	10	2
α-helix	267-282	16
β-strand	289	1	2
α-helix	293-296	4
α-helix	305-312	8

Chain E: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	3
α-helix	14-24	11
β-strand	30	1	3
β-strand	36-44	9	3
β-strand	56-62	7	3
β-strand	68-72	5	3
β-strand	76-81	6	3
α-helix	84-86	3
α-helix	89-93	5
α-helix	104-111	8
β-strand	116-125	10	3
β-strand	128-132	5	3
β-strand	135-144	10	3
β-strand	147-156	10	3
α-helix	164-174	11
β-strand	183-185	3	3
α-helix	196-208	13

Chain F: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	3
α-helix	13-15	3
α-helix	16-27	12
β-strand	32-43	12	3
β-strand	64-68	5	3
α-helix	72-74	3
α-helix	78-81	4
α-helix	86-92	7
α-helix	98-99	2
β-strand	164-170	7	3
β-strand	181-195	15	3
α-helix	200-205	6
β-strand	209-223	15	3
β-strand	229-237	9	3
β-strand	244-245	2	3
β-strand	250-259	10	3
α-helix	265-282	18
β-strand	289	1	3
α-helix	290-292	3
α-helix	293-297	5
α-helix	299-301	3
α-helix	305-310	6

Chain G: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	4
α-helix	15-22	8
β-strand	30-31	2	4
β-strand	36-44	9	4
β-strand	56-63	8	4
β-strand	67-73	7	4
β-strand	76-81	6	4
α-helix	84-86	3
α-helix	89-93	5
α-helix	104-111	8
β-strand	116-123	8	4
β-strand	128-132	5	4
β-strand	135-143	9	4
β-strand	148-156	9	4
α-helix	164-170	7
β-strand	183-185	3	4
α-helix	197-208	12

Chain H: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	4
α-helix	16-27	12
β-strand	32-43	12	4
β-strand	64-68	5	4
α-helix	72-75	4
α-helix	85-94	10
α-helix	161-163	3
β-strand	164-170	7	4
β-strand	181-195	15	4
α-helix	200-205	6
β-strand	209-223	15	4
β-strand	229-238	10	4
β-strand	243-245	3	4
β-strand	250-259	10	4
α-helix	265-282	18
β-strand	289	1	4
α-helix	299-301	3
α-helix	305-312	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II mediator complex subunit 20	A, C, E, G	protein	212	Saccharomyces cerevisiae	P34162 (AlphaFold model)
RNA polymerase II mediator complex subunit 18	B, D, F, H	protein	317	Saccharomyces cerevisiae	P32585 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>2HZM_1 RNA polymerase II mediator complex subunit 20 (chains A, C, E, G)
ASMGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMY
SITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQ
RQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIR
AKEYKTSSDSLGPDTSNEICDLAYQYVRALEL

Sequence of entity 2 (B, D, F, H), FASTA

>2HZM_2 RNA polymerase II mediator complex subunit 18 (chains B, D, F, H)
VQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEP
NRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNS
TNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVS
MQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEA
GNSQITSGGFLLKAYINVSRGTDIDRINYTETVLMNLKKELQGYIELSVPDRQSMDSRVA
HGNILIAAALEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Lariviere, L., Geiger, S., Hoeppner, S. et al. Nat Struct Mol Biol (2006) 13:895-901. DOI 10.1038/nsmb1143 · PubMed

Other PDB entries of the same protein (UniProt P34162 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HZS 2.7 Å, Structure of the Mediator head submodule Med8C/18/20
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
9PC8 3.4 Å, Core Mediator of PIC-Med-SWI/SNF
8CEO 3.6 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator and the…
4GWP 4.2 Å, Structure of the Mediator Head Module from S. cerevisiae
3RJ1 4.3 Å, Architecture of the Mediator Head module
7UIG 4.3 Å, Mediator-PIC Early (Mediator A)
4GWQ 4.5 Å, Structure of the Mediator Head Module from S. cerevisiae in complex with the…
7UIF 4.6 Å, Mediator-PIC Early (Core B)
5OQM 5.8 Å, Structure of yeast transcription pre-initiation complex with tfiih and core mediator

Browse structure collections

About this viewer

MolViewer shows 2HZM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.