3RJ1: Architecture of the Mediator Head module
Architecture of the Mediator Head module. Determined by X-ray diffraction at 4.3 Å resolution. Released 27 Jul 2011.
- Method
- X-ray diffraction
- Resolution
- 4.3 Å
- Organism
- Saccharomyces cerevisiae
- Chains
- 21
- Atoms
- 17,945
- Mol. weight
- 636.19 kDa
- Ligands
- SE
- Released
- 27 Jul 2011
Explore 3RJ1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3RJ1 contains 172 α-helices and 102 β-strands across 21 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, H and O: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-25 | 4 | |
| α-helix | 37-40 | 4 | |
| α-helix | 45-52 | 8 | |
| α-helix | 61-72 | 12 | |
| α-helix | 73-75 | 3 | |
| α-helix | 113-115 | 3 | |
| α-helix | 119-128 | 10 | |
Chains B and I: 17 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 200-207 | 8 | |
| α-helix | 216-228 | 13 | |
| α-helix | 272-275 | 4 | |
| α-helix | 287-299 | 13 | |
| α-helix | 302-311 | 10 | |
| α-helix | 312-314 | 3 | |
| α-helix | 425-428 | 4 | |
| α-helix | 435-453 | 19 | |
| α-helix | 469 | 1 | |
| α-helix | 472 | 1 | |
| α-helix | 485-487 | 3 | |
| α-helix | 503-524 | 22 | |
| α-helix | 556-563 | 8 | |
| α-helix | 566-569 | 4 | |
| α-helix | 571-574 | 4 | |
| α-helix | 601-611 | 11 | |
| β-strand | 1621-1622 | 2 | 1 |
| β-strand | 1721-1722 | 2 | 1 |
| α-helix | 675-683 | 9 | |
Chains C, J and Q: 9 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-54 | 17 | |
| α-helix | 63-82 | 20 | |
| α-helix | 107-109 | 3 | |
| α-helix | 112-116 | 5 | |
| α-helix | 121-123 | 3 | |
| α-helix | 147-158 | 12 | |
| α-helix | 164-167 | 4 | |
| α-helix | 196-198 | 3 | |
| α-helix | 199-203 | 5 | |
Chains D, K and R: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-11 | 6 | |
| α-helix | 15-21 | 7 | |
| α-helix | 49-77 | 29 | |
| α-helix | 105-108 | 4 | |
Chains E, L and S: 10 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 2 |
| β-strand | 10-11 | 2 | 3 |
| α-helix | 16-25 | 10 | |
| β-strand | 33 | 1 | 2 |
| β-strand | 36 | 1 | 4 |
| β-strand | 39-41 | 3 | 5 |
| α-helix | 42 | 1 | |
| α-helix | 44 | 1 | |
| α-helix | 62-63 | 2 | |
| β-strand | 64-66 | 3 | 5 |
| α-helix | 72-75 | 4 | |
| α-helix | 79-82 | 4 | |
| β-strand | 166-170 | 5 | 2 |
| β-strand | 182-188 | 7 | 2 |
| β-strand | 193-195 | 3 | 6 |
| α-helix | 202-205 | 4 | |
| β-strand | 214 | 1 | 5 |
| β-strand | 216-217 | 2 | 4 |
| β-strand | 220-224 | 5 | 2 |
| β-strand | 228-232 | 5 | 2 |
| β-strand | 233 | 1 | 3 |
| β-strand | 235-237 | 3 | 4 |
| β-strand | 244-245 | 2 | 4 |
| β-strand | 251-252 | 2 | 3 |
| β-strand | 255-258 | 4 | 2 |
| α-helix | 259 | 1 | |
| α-helix | 273-282 | 10 | |
| α-helix | 290-292 | 3 | |
Chains F and M: 5 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-9 | 5 | 7 |
| α-helix | 21-24 | 4 | |
| β-strand | 37-43 | 7 | 6 |
| β-strand | 57-62 | 6 | 6 |
| β-strand | 69-73 | 5 | 6 |
| β-strand | 76-79 | 4 | 6 |
| α-helix | 90-93 | 4 | |
| β-strand | 101 | 1 | 2 |
| α-helix | 104-111 | 8 | |
| β-strand | 117-122 | 6 | 6 |
| β-strand | 123 | 1 | 8 |
| β-strand | 128-130 | 3 | 7 |
| β-strand | 135-140 | 6 | 7 |
| β-strand | 143 | 1 | 8 |
| β-strand | 148 | 1 | 8 |
| β-strand | 151-157 | 7 | 7 |
| α-helix | 163-166 | 4 | |
| β-strand | 184 | 1 | 7 |
| α-helix | 202-205 | 4 | |
Chains G, N and U: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 16-22 | 7 | |
| α-helix | 34-37 | 4 | |
| α-helix | 52-55 | 4 | |
| α-helix | 101-105 | 5 | |
| α-helix | 176-186 | 11 | |
Chain P: 17 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 200-207 | 8 | |
| α-helix | 216-228 | 13 | |
| α-helix | 272-275 | 4 | |
| α-helix | 287-299 | 13 | |
| α-helix | 302-311 | 10 | |
| α-helix | 312-314 | 3 | |
| α-helix | 425-428 | 4 | |
| α-helix | 435-453 | 19 | |
| α-helix | 469 | 1 | |
| α-helix | 472 | 1 | |
| α-helix | 485-487 | 3 | |
| α-helix | 499-524 | 26 | |
| α-helix | 556-563 | 8 | |
| α-helix | 566-569 | 4 | |
| α-helix | 571-574 | 4 | |
| α-helix | 601-611 | 11 | |
| β-strand | 1621-1622 | 2 | 17 |
| β-strand | 1721-1722 | 2 | 17 |
| α-helix | 675-683 | 9 | |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Mediator of RNA polymerase II transcription subunit 11 | A, H, O | protein | 131 | Saccharomyces cerevisiae | Q99278 (AlphaFold model) |
| Mediator of RNA polymerase II transcription subunit 17 | B, I, P | protein | 583 | Saccharomyces cerevisiae | P32569 (AlphaFold model) |
| Mediator of RNA polymerase II transcription subunit 8 | C, J, Q | protein | 223 | Saccharomyces cerevisiae | P38304 (AlphaFold model) |
| Mediator of RNA polymerase II transcription subunit 22 | D, K, R | protein | 121 | Saccharomyces cerevisiae | P32570 (AlphaFold model) |
| Mediator of RNA polymerase II transcription subunit 18 | E, L, S | protein | 275 | Saccharomyces cerevisiae | P32585 |
| Mediator of RNA polymerase II transcription subunit 20 | F, M, T | protein | 210 | Saccharomyces cerevisiae | P34162 |
| Mediator of RNA polymerase II transcription subunit 6 | G, N, U | protein | 295 | Saccharomyces cerevisiae | P38782 |
Sequence of entity 1 (A, H, O), FASTA
>3RJ1_1 Mediator of RNA polymerase II transcription subunit 11 (chains A, H, O)
MQVLNTKSETKQENEGSQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESV
KPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDL
LSAILDPSKSK
Sequence of entity 2 (B, I, P), FASTA
>3RJ1_2 Mediator of RNA polymerase II transcription subunit 17 (chains B, I, P)
MHHHHHHHHHHQRGPGFKFVDLNEKELQNEIKQLGSDSSDGHNSEKKDTDGADENVQIGE
DFMEVDYEDKDNPVDSRNETDHKTNENGETDDNIETVMTQEQFVKRRRDMLEHINLAMNE
SSLALEFVSLLLSSVKESTGMSSMSPFLRKVVKPSSLNSDKIPYVAPTKKEYIELDILNK
GWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNKDVIFKIRDRTSGQKLLAI
KYGYEDSGSTYKHDRGIANIRNNIESQNLDLIPHSSSVFKGTDFVHSVKKFLRVRIFTKI
ESEDDYILSGESVMDRDSESEEAETKDIRKQIQLLKKIIFEKELMYQIKKECALLISYGV
SIENENKVIIELPNEKFEIELLSLDDDSIVNHEQDLPKINDKRANLMLVMLRLLLVVIFK
KTLRSRISSPHGLINLNVDDDILIIRPILGKVRFANYKLLLKKIIKDYVLDIVPGSSITE
TEVEREQPQENKNIDDENITKLNKEIRAFDKLLNIPRREXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXEVEDFLHFIVAEYIQQKKV
Sequence of entity 3 (C, J, Q), FASTA
>3RJ1_3 Mediator of RNA polymerase II transcription subunit 8 (chains C, J, Q)
MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELP
QWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIP
EVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSE
EHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN
Sequence of entity 4 (D, K, R), FASTA
>3RJ1_4 Mediator of RNA polymerase II transcription subunit 22 (chains D, K, R)
MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNN
QTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKT
T
Sequence of entity 5 (E, L, S), FASTA
>3RJ1_5 Mediator of RNA polymerase II transcription subunit 18 (chains E, L, S)
MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVE
PNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNINSDDIIDVDMDA
SPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFE
FQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTE
TALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI
Sequence of entity 6 (F, M, T), FASTA
>3RJ1_6 Mediator of RNA polymerase II transcription subunit 20 (chains F, M, T)
MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSI
TFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQ
LIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAK
EYKTSSDSLGPDTSNEICDLAYQYVRALEL
Sequence of entity 7 (G, N, U), FASTA
>3RJ1_7 Mediator of RNA polymerase II transcription subunit 6 (chains G, N, U)
MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNA
AVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSV
REPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYH
LNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMAT
VPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| SE | Selenium atom | Se | 98 |
Primary citation
Architecture of the Mediator head module. Imasaki, T., Calero, G., Cai, G. et al. Nature (2011) 475:240-243. DOI 10.1038/nature10162 · PubMed
Other PDB entries of the same protein (UniProt Q99278 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3R84 2.05 Å, Structure of the Mediator head subcomplex Med11/22
- 4H62 3.0 Å, Structure of the Saccharomyces cerevisiae Mediator subcomplex Med17C/Med11C/Med22C
- 8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
- 7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
- 7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
- 9PC8 3.4 Å, Core Mediator of PIC-Med-SWI/SNF
- 8CEO 3.6 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator and the…
- 4GWP 4.2 Å, Structure of the Mediator Head Module from S. cerevisiae
- 7UIG 4.3 Å, Mediator-PIC Early (Mediator A)
- 4GWQ 4.5 Å, Structure of the Mediator Head Module from S. cerevisiae in complex with the…
- 7UIF 4.6 Å, Mediator-PIC Early (Core B)
- 5OQM 5.8 Å, Structure of yeast transcription pre-initiation complex with tfiih and core mediator
Browse structure collections
About this viewer
MolViewer shows 3RJ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.