2I0L: Sap97 PDZ2

X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6. Determined by X-ray diffraction at 2.31 Å resolution. Released 20 Feb 2007.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 1,472
Mol. weight: 19.58 kDa
Released: 20 Feb 2007

Explore 2I0L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I0L contains 5 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	319-322	4	1
β-strand	330-334	5	2
β-strand	336	1	3
β-strand	341	1	4
β-strand	344	1	4
β-strand	347-352	6	2
α-helix	357-361	5
α-helix	368	1
β-strand	369-370	2	2
β-strand	372-373	2	1
β-strand	376-377	2	1
β-strand	382	1	3
α-helix	383-391	9
β-strand	396-399	4	1

Chain B: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	319-322	4	5
β-strand	324	1	6
β-strand	327	1	6
β-strand	330-334	5	7
β-strand	336	1	8
β-strand	341	1	9
β-strand	344	1	9
β-strand	347-352	6	7
α-helix	357-361	5
β-strand	369	1	7
β-strand	372-373	2	5
β-strand	376-377	2	5
β-strand	382	1	8
α-helix	383-391	9
β-strand	396-399	4	5

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2003-2005	3	2

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2004-2005	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A, B	protein	84	Rattus norvegicus	Q62696 (AlphaFold model)
peptide E6	C, D	protein	7		P06463 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2I0L_1 Disks large homolog 1 (chains A, B)
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVC
LEEVTHEEAVTALKNTSDFVYLKA

Sequence of entity 2 (C, D), FASTA

>2I0L_2 peptide E6 (chains C, D)
RRRETQV

Primary citation

Structures of a Human Papillomavirus (HPV) E6 Polypeptide Bound to MAGUK Proteins: Mechanisms of Targeting Tumor Suppressors by a High-Risk HPV Oncoprotein. Zhang, Y., Dasgupta, J., Ma, R.Z. et al. J Virol (2007) 81:3618-3626. DOI 10.1128/JVI.02044-06 · PubMed

Other PDB entries of the same protein (UniProt Q62696 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AWX 1.8 Å, Synapse associated protein 97 PDZ2 domain variant C378S
2AWW 2.21 Å, Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
2G2L 2.35 Å, Crystal Structure of the Second PDZ Domain of SAP97 in Complex with a GluR-A C-terminal…
2AWU 2.44 Å, Synapse associated protein 97 PDZ2 domain variant C378G
3UAT 2.7 Å, Guanylate Kinase Domains of the MAGUK Family Scaffold Proteins as Specific…
2I0I 2.8 Å, X-ray crystal structure of Sap97 PDZ3 bound to the C-terminal peptide of HPV18 E6
1RSO Hetero-tetrameric L27 (Lin-2, Lin-7) domain complexes as organization platforms of…
1ZOK PDZ1 Domain Of Synapse Associated Protein 97

Browse structure collections

About this viewer

MolViewer shows 2I0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.