2I3T: Bub3 complex with Mad3 (BubR1) GLEBS motif
Bub3 complex with Mad3 (BubR1) GLEBS motif. Determined by X-ray diffraction at 2.8 Å resolution. Released 9 Jan 2007.
- Method
- X-ray diffraction
- Resolution
- 2.8 Å
- Organism
- Saccharomyces cerevisiae
- Chains
- 8
- Atoms
- 11,816
- Mol. weight
- 180.24 kDa
- Released
- 9 Jan 2007
Explore 2I3T in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2I3T contains 42 α-helices and 140 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, E and G: 8 helices, 32 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 1 |
| α-helix | 13 | 1 | |
| β-strand | 14-20 | 7 | 2 |
| α-helix | 21-23 | 3 | |
| β-strand | 25-30 | 6 | 2 |
| β-strand | 34-41 | 8 | 2 |
| β-strand | 46-54 | 9 | 2 |
| β-strand | 59-65 | 7 | 3 |
| β-strand | 71-76 | 6 | 3 |
| β-strand | 81-84 | 4 | 3 |
| β-strand | 92-94 | 3 | 3 |
| α-helix | 95 | 1 | |
| β-strand | 96 | 1 | 4 |
| β-strand | 104-110 | 7 | 5 |
| β-strand | 114-119 | 6 | 5 |
| β-strand | 123-127 | 5 | 5 |
| α-helix | 129-132 | 4 | |
| β-strand | 135 | 1 | 4 |
| β-strand | 137-141 | 5 | 5 |
| β-strand | 153-159 | 7 | 6 |
| β-strand | 162-167 | 6 | 6 |
| α-helix | 168-170 | 3 | |
| β-strand | 171-176 | 6 | 6 |
| β-strand | 187-189 | 3 | 6 |
| β-strand | 196-201 | 6 | 7 |
| β-strand | 208-213 | 6 | 7 |
| β-strand | 217-223 | 7 | 7 |
| β-strand | 233-239 | 7 | 7 |
| β-strand | 242-244 | 3 | 8 |
| β-strand | 249-251 | 3 | 8 |
| β-strand | 254-259 | 6 | 9 |
| β-strand | 266-270 | 5 | 9 |
| β-strand | 275-279 | 5 | 9 |
| β-strand | 284-289 | 6 | 9 |
| α-helix | 290-291 | 2 | |
| β-strand | 296-302 | 7 | 1 |
| β-strand | 306-312 | 7 | 1 |
| α-helix | 315-318 | 4 | |
| α-helix | 328-331 | 4 | |
| β-strand | 332-337 | 6 | 1 |
Chain B: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 355 | 1 | |
| β-strand | 356-358 | 3 | 8 |
| α-helix | 362-365 | 4 | |
| β-strand | 366 | 1 | 10 |
| β-strand | 378 | 1 | 10 |
| α-helix | 381-387 | 7 | |
Chain C: 7 helices, 32 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 11 |
| α-helix | 13 | 1 | |
| β-strand | 14-20 | 7 | 12 |
| α-helix | 21-23 | 3 | |
| β-strand | 25-30 | 6 | 12 |
| β-strand | 34-41 | 8 | 12 |
| β-strand | 46-54 | 9 | 12 |
| β-strand | 59-65 | 7 | 13 |
| β-strand | 71-76 | 6 | 13 |
| β-strand | 81-84 | 4 | 13 |
| β-strand | 92-94 | 3 | 13 |
| β-strand | 96 | 1 | 14 |
| β-strand | 104-110 | 7 | 15 |
| β-strand | 114-119 | 6 | 15 |
| β-strand | 123-127 | 5 | 15 |
| α-helix | 129-132 | 4 | |
| β-strand | 135 | 1 | 14 |
| β-strand | 137-141 | 5 | 15 |
| β-strand | 153-159 | 7 | 16 |
| β-strand | 162-167 | 6 | 16 |
| α-helix | 168-170 | 3 | |
| β-strand | 171-176 | 6 | 16 |
| β-strand | 187-189 | 3 | 16 |
| β-strand | 196-201 | 6 | 17 |
| β-strand | 208-213 | 6 | 17 |
| β-strand | 217-223 | 7 | 17 |
| β-strand | 233-239 | 7 | 17 |
| β-strand | 242-244 | 3 | 18 |
| β-strand | 249-251 | 3 | 18 |
| β-strand | 254-259 | 6 | 19 |
| β-strand | 266-270 | 5 | 19 |
| β-strand | 275-279 | 5 | 19 |
| β-strand | 284-289 | 6 | 19 |
| α-helix | 290-291 | 2 | |
| β-strand | 296-302 | 7 | 11 |
| β-strand | 306-312 | 7 | 11 |
| α-helix | 315-318 | 4 | |
| α-helix | 328-331 | 4 | |
| β-strand | 332-337 | 6 | 11 |
Chain D: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 354-356 | 3 | |
| β-strand | 357-358 | 2 | 18 |
| α-helix | 362-365 | 4 | |
| β-strand | 366 | 1 | 20 |
| β-strand | 378 | 1 | 20 |
| α-helix | 381-388 | 8 | |
Chain F: 2 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 356-358 | 3 | 27 |
| α-helix | 362-365 | 4 | |
| β-strand | 366 | 1 | 29 |
| β-strand | 378 | 1 | 29 |
| α-helix | 381-388 | 8 | |
Chain H: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 354-355 | 2 | |
| β-strand | 356-358 | 3 | 36 |
| α-helix | 362-365 | 4 | |
| β-strand | 366 | 1 | 38 |
| β-strand | 378 | 1 | 38 |
| α-helix | 381-388 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cell cycle arrest protein | A, C, E, G | protein | 341 | Saccharomyces cerevisiae | P26449 (AlphaFold model) |
| Spindle assembly checkpoint component | B, D, F, H | protein | 54 | Saccharomyces cerevisiae | P47074 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G), FASTA
>2I3T_1 Cell cycle arrest protein (chains A, C, E, G)
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN
Sequence of entity 2 (B, D, F, H), FASTA
>2I3T_2 Spindle assembly checkpoint component (chains B, D, F, H)
MKPEKIDCNFKLIYCEDEESKGGRLEFSLEEVLAISRNVYKRVRTNRKHHHHHH
Primary citation
Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen, N.A., Al-Bassam, J., Wei, R.R. et al. Proc Natl Acad Sci U S A (2007) 104:1201-1206. DOI 10.1073/pnas.0610358104 · PubMed
Other PDB entries of the same protein (UniProt P26449 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1YFQ 1.1 Å, High resolution S. cerevisiae Bub3 mitotic checkpoint protein
- 2I3S 1.9 Å, Bub3 complex with Bub1 GLEBS motif
- 4BL0 1.95 Å, Crystal structure of yeast Bub3-Bub1 bound to phospho-Spc105
- 1U4C 2.35 Å, Structure of spindle checkpoint protein Bub3
Browse structure collections
About this viewer
MolViewer shows 2I3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.