2I9B: ATF-urokinase receptor complex

Crystal structure of ATF-urokinase receptor complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 2 Jan 2007.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 8
Atoms: 11,892
Mol. weight: 192.25 kDa
Released: 2 Jan 2007

Explore 2I9B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I9B contains 24 α-helices and 152 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	1
β-strand	29-32	4	1
β-strand	37-38	2	2
β-strand	44-45	2	2
β-strand	51	1	3
β-strand	64	1	4
β-strand	65	1	5
α-helix	69	1
β-strand	70	1	4
α-helix	71-73	3
α-helix	79-81	3
α-helix	91-94	4
β-strand	103	1	6
β-strand	112-117	6	6
β-strand	120-125	6	6
β-strand	126	1	5
β-strand	130	1	3

Chains C and D: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	13
β-strand	29-32	4	13
β-strand	38	1	14
β-strand	44	1	14
β-strand	45	1	15
β-strand	51	1	16
β-strand	60	1	15
β-strand	64	1	17
β-strand	65	1	18
α-helix	69	1
β-strand	70	1	17
α-helix	71-73	3
α-helix	79-81	3
β-strand	103	1	19
β-strand	112-115	4	19
β-strand	122-125	4	19
β-strand	126	1	18
β-strand	130	1	16

Chains E and F: 2 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	27
β-strand	12-16	5	27
α-helix	17-18	2
β-strand	23-33	11	27
β-strand	37-46	10	27
β-strand	53-58	6	27
β-strand	62-71	10	27
β-strand	94-97	4	28
β-strand	98-99	2	27
β-strand	111-114	4	28
β-strand	121-128	8	27
β-strand	139	1	1
β-strand	143-149	7	27
β-strand	155-160	6	27
β-strand	165-171	7	27
α-helix	184-186	3
β-strand	189-196	8	29
β-strand	197	1	27
β-strand	200	1	30
β-strand	204	1	30
β-strand	211-216	6	29
β-strand	221-228	8	27
β-strand	235-242	8	27
β-strand	259	1	27
β-strand	264-266	3	27

Chains G and H: 3 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	35
β-strand	12-15	4	35
β-strand	23-30	8	35
β-strand	39-46	8	35
β-strand	53-58	6	35
β-strand	63-71	9	35
β-strand	95-97	3	36
β-strand	98-99	2	35
β-strand	111-113	3	36
β-strand	121-128	8	35
β-strand	140	1	13
β-strand	143-149	7	35
β-strand	156-160	5	35
β-strand	165-171	7	35
α-helix	184-186	3
α-helix	188	1
β-strand	189-196	8	37
β-strand	197-198	2	35
β-strand	200	1	38
β-strand	204	1	38
β-strand	211-216	6	37
β-strand	221-225	5	35
β-strand	228-229	2	39
β-strand	234-235	2	39
β-strand	238-242	5	35
β-strand	259	1	39
β-strand	263-266	4	35
α-helix	274-276	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Urokinase-type plasminogen activator	A, B, C, D	protein	145	Homo sapiens	P00749 (AlphaFold model)
Urokinase plasminogen activator surface receptor	E, F, G, H	protein	279	Homo sapiens	Q03405 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2I9B_1 Urokinase-type plasminogen activator (chains A, B, C, D)
RSSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFY
RGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVG
LKPLVQECMVHDCADGKKPSSPPEE

Sequence of entity 2 (E, F, G, H), FASTA

>2I9B_2 Urokinase plasminogen activator surface receptor (chains E, F, G, H)
RSLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYR
TGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP
EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNQDTFHFLKCCQTTKCNE
GPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKQQSYMV
RGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLD

Primary citation

Structural basis of interaction between urokinase-type plasminogen activator and its receptor. Barinka, C., Parry, G., Callahan, J. et al. J Mol Biol (2006) 363:482-495. DOI 10.1016/j.jmb.2006.08.063 · PubMed

Other PDB entries of the same protein (UniProt P00749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YC6 1.18 Å, The crystal structure of uPA in complex with 4-Bromobenzylamirne at pH4.6
4ZKO 1.29 Å, The crystal structure of upain-1-W3A in complex with uPA at pH7.4
4ZKN 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH5.5
4ZKR 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH9.0
6XVD 1.4 Å, Crystal structure of complex of urokinase and a upain-1 variant(W3F) in pH7.4 condition
2O8T 1.45 Å, Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator…
3MHW 1.45 Å, The complex crystal Structure of Urokianse and 2-Aminobenzothiazole
5Z1C 1.45 Å, The crystal structure of uPA in complex with 4-Iodobenzylamine at pH7.4
5WXF 1.46 Å, Crystal structure of uPA in complex with upain-2-2
4MNW 1.49 Å, Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic…
1GJ7 1.5 Å, Engineering inhibitors highly selective for the S1 sites of SER190 trypsin-like serine…
4XSK 1.5 Å, Structure of PAItrap, an uPA mutant

Browse structure collections

About this viewer

MolViewer shows 2I9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.