Crystal structure analysis of ColE1 ROM mutant F14Y. Determined by X-ray diffraction at 1.9 Å resolution. Released 16 Oct 2007.
Explore 2IJJ in 3D Show helices and sheets RCSB PDB PDBe
2IJJ contains 6 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-28 | 26 | |
| α-helix | 32-56 | 25 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-28 | 26 | |
| α-helix | 32-55 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Regulatory protein rop | A, B, C | protein | 63 | Escherichia coli | P03051 (AlphaFold model) |
>2IJJ_1 Regulatory protein rop (chains A, B, C) GTKQEKTALNMARYIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGDDG ENL
New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition. Struble, E.B., Ladner, J.E., Brabazon, D.M. et al. Proteins (2008) 72:761-768. DOI 10.1002/prot.21965 · PubMed
Other PDB entries of the same protein (UniProt P03051 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IJJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.