Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 3. Determined by X-ray diffraction at 1.76 Å resolution. Released 14 Nov 2006.
Explore 2IOS in 3D Show helices and sheets RCSB PDB PDBe
2IOS contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 326-341 | 16 | |
| α-helix | 344-354 | 11 | |
| α-helix | 357-359 | 3 | |
| α-helix | 360-373 | 14 | |
| α-helix | 378-392 | 15 | |
| α-helix | 398-418 | 21 | |
| α-helix | 422-435 | 14 | |
| α-helix | 441-445 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Programmed Cell Death 4, Pdcd4 | A | protein | 150 | Mus musculus | Q61823 (AlphaFold model) |
>2IOS_1 Programmed Cell Death 4, Pdcd4 (chains A) GQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESA FKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGII SKQLRDLCPSRGRKRFVSEGDGGRLKPESY
Structural basis for inhibition of translation by the tumor suppressor pdcd4. Laronde-Leblanc, N., Santhanam, A.N., Baker, A.R. et al. Mol Cell Biol (2007) 27:147-156. DOI 10.1128/MCB.00867-06 · PubMed
Other PDB entries of the same protein (UniProt Q61823 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IOS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.