2IS1: UvrD-DNA-SO4 complex

Crystal structure of UvrD-DNA-SO4 complex. Determined by X-ray diffraction at 2.9 Å resolution. Released 9 Jan 2007.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Escherichia coli
Chains: 6
Atoms: 10,896
Mol. weight: 173.51 kDa
Ligands: HG
Released: 9 Jan 2007

Explore 2IS1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IS1 contains 69 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
α-helix	12-19	8
α-helix	21	1
β-strand	25-29	5	1
α-helix	35-48	14
α-helix	54-56	3
β-strand	57-61	5	1
α-helix	64-77	14
β-strand	86-89	4	1
α-helix	90-100	11
β-strand	112-114	3	2
α-helix	116-128	13
α-helix	139-150	12
α-helix	156-158	3
α-helix	165-184	20
β-strand	186-188	3	2
α-helix	189-202	14
α-helix	204-213	10
β-strand	216-219	4	1
α-helix	222-224	3
α-helix	227-237	11
β-strand	242-247	6	1
α-helix	255-257	3
α-helix	263-269	7
β-strand	275-279	5	1
β-strand	281	1	3
α-helix	287-298	12
β-strand	309	1	3
α-helix	317	1
β-strand	318-325	8	4
α-helix	326-342	17
α-helix	347-349	3
β-strand	350-354	5	4
α-helix	357-359	3
α-helix	360-369	10
β-strand	374-377	4	4
α-helix	382-384	3
α-helix	386-399	14
α-helix	404-410	7
α-helix	420-432	13
α-helix	437-447	11
α-helix	452-471	20
α-helix	477-487	11
α-helix	490-495	6
α-helix	499-518	20
α-helix	530-540	11
β-strand	554-558	5	4
α-helix	560-562	3
β-strand	567-572	6	4
β-strand	576	1	5
α-helix	592-603	12
β-strand	606-617	12	4
β-strand	618	1	6
β-strand	625	1	6
β-strand	629	1	5
α-helix	631-634	4
β-strand	641-644	4	4

Chain B: 33 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	12-18	7
β-strand	25-29	5	7
α-helix	35-48	14
α-helix	54-56	3
β-strand	57-61	5	7
α-helix	64-75	12
β-strand	86-89	4	7
α-helix	90-100	11
β-strand	112-114	3	8
α-helix	116-129	14
α-helix	134-136	3
α-helix	139-151	13
α-helix	170-184	15
β-strand	186-188	3	8
α-helix	189-202	14
α-helix	204-211	8
β-strand	216-219	4	7
α-helix	222-224	3
α-helix	227-237	11
β-strand	242-247	6	7
α-helix	249-251	3
α-helix	263-268	6
β-strand	277-279	3	7
β-strand	281	1	9
α-helix	287-298	12
β-strand	309	1	9
α-helix	317-318	2
β-strand	319-323	5	10
α-helix	326-342	17
α-helix	347-349	3
β-strand	351-354	4	10
α-helix	361-370	10
β-strand	375-377	3	10
α-helix	382-384	3
α-helix	386-399	14
α-helix	404-410	7
α-helix	420-432	13
α-helix	437-447	11
α-helix	452-471	20
α-helix	477-486	10
α-helix	490-495	6
α-helix	500-517	18
α-helix	530-540	11
β-strand	555-558	4	10
α-helix	560-562	3
β-strand	567-570	4	11
β-strand	572-573	2	10
β-strand	576	1	12
α-helix	593-603	11
β-strand	606-610	5	11
β-strand	611-615	5	10
β-strand	618-620	3	13
β-strand	623-625	3	13
β-strand	629	1	12
α-helix	632-635	4
β-strand	643	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(gpcpapgptpgpcptpcpgptptptptptptp*t)-3'	C, E	DNA	17
5'-d(cpgpapgpcpapcptpgpc)-3'	D, F	DNA	10
DNA helicase II	A, B	protein	680	Escherichia coli	P03018 (AlphaFold model)

Sequence of entity 1 (C, E), FASTA

>2IS1_1 5'-D(*GP*CP*AP*GP*TP*GP*CP*TP*CP*GP*TP*TP*TP*TP*TP*TP*T)-3' (chains C, E)
GCAGTGCTCGTTTTTTT

Sequence of entity 2 (D, F), FASTA

>2IS1_2 5'-D(*CP*GP*AP*GP*CP*AP*CP*TP*GP*C)-3' (chains D, F)
CGAGCACTGC

Sequence of entity 3 (A, B), FASTA

>2IS1_3 DNA helicase II (chains A, B)
MDVSYLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVENCSPYSIMAV
TFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHGLAHRLLRAHHMDANLPQDFQILDSEDQL
RLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQSYGNPVEQTWQKVYQAYQEA
CDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDT
GKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENN
NGRLGKKLWTDGADGEPISLYCAFNELDEARFVVNRIKTWQDNGGALAECAILYRSNAQS
RVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIVNRNDDAAFERVVNTPTRGIGD
RTLDVVRQTSRDRQLTLWQACRELLQEKALAGRAASALQRFMELIDALAQETADMPLHVQ
TDRVIKDSGLRTMYEQEKGEKGQTRIENLEELVTATRQFSYNEEDEDLMPLQAFLSHAAL
EAGEGQADTWQDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAY
VGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGELPEECVEEVRLRATVSRPVSHQRMG
TPMVENDSGYKLGQRVRHAK

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	5

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke. Lee, J.Y., Yang, W. Cell (2006) 127:1349-1360. DOI 10.1016/j.cell.2006.10.049 · PubMed

Other PDB entries of the same protein (UniProt P03018 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EGS 1.7 Å, The crystal structure of lobe domain of E. coli RNA polymerase complexed with the…
3LFU 1.8 Å, Crystal Structure of E. coli UvrD
2IS6 2.2 Å, Crystal structure of UvrD-DNA-ADPMgF3 ternary complex
2IS4 2.6 Å, Crystal structure of UvrD-DNA-ADPNP ternary complex
2IS2 3.0 Å, Crystal structure of UvrD-DNA binary complex
6YI2 UvrD helicase RNA polymerase interactions are governed by UvrDs carboxy terminal Tudor…

Browse structure collections

About this viewer

MolViewer shows 2IS1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.