2IS2: UvrD-DNA binary complex

Crystal structure of UvrD-DNA binary complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 9 Jan 2007.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Escherichia coli
Chains: 4
Atoms: 11,505
Mol. weight: 177.27 kDa
Released: 9 Jan 2007

Explore 2IS2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IS2 contains 66 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	12-18	7
β-strand	25-29	5	1
α-helix	35-48	14
β-strand	57-61	5	1
α-helix	64-77	14
β-strand	86-89	4	1
α-helix	90-100	11
α-helix	103-105	3
β-strand	112-114	3	2
α-helix	116-128	13
α-helix	133-136	4
α-helix	139-151	13
α-helix	165-184	20
β-strand	186-188	3	2
α-helix	189-202	14
α-helix	204-213	10
β-strand	216-219	4	1
α-helix	222-224	3
α-helix	227-235	9
β-strand	242-247	6	1
α-helix	249-251	3
α-helix	263-270	8
β-strand	275-279	5	1
β-strand	281	1	3
α-helix	287-297	11
β-strand	309	1	3
α-helix	317	1
β-strand	318-321	4	4
β-strand	325	1	5
α-helix	326-342	17
α-helix	347-349	3
β-strand	350-354	5	4
α-helix	359-369	11
β-strand	374-376	3	4
α-helix	382-384	3
α-helix	386-399	14
α-helix	404-410	7
α-helix	420-433	14
α-helix	439-446	8
α-helix	452-472	21
α-helix	477-487	11
α-helix	490-495	6
α-helix	500-518	19
α-helix	530-540	11
β-strand	554-558	5	4
α-helix	560-562	3
β-strand	567-572	6	4
β-strand	576	1	6
β-strand	578-579	2	7
β-strand	582	1	7
α-helix	584-587	4
α-helix	592-603	12
β-strand	606-613	8	4
β-strand	617	1	5
β-strand	618-620	3	8
β-strand	623-625	3	8
β-strand	629	1	6
α-helix	631-635	5
α-helix	638-640	3
β-strand	641-642	2	4

Chain B: 31 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	12-18	7
β-strand	27-28	2	9
α-helix	35-47	13
β-strand	58-61	4	10
α-helix	64-77	14
β-strand	86-89	4	10
α-helix	90-100	11
β-strand	112-114	3	11
α-helix	116-128	13
α-helix	139-150	12
α-helix	165-184	20
β-strand	186-188	3	11
α-helix	189-199	11
α-helix	204-211	8
β-strand	216-217	2	12
α-helix	222-224	3
α-helix	227-236	10
β-strand	242-243	2	12
β-strand	246-247	2	9
α-helix	249-251	3
α-helix	263-270	8
β-strand	281	1	13
α-helix	287-298	12
β-strand	309	1	13
β-strand	318-319	2	14
β-strand	320	1	15
β-strand	323-325	3	16
α-helix	326-342	17
β-strand	352-354	3	15
α-helix	357-359	3
α-helix	360-368	9
α-helix	382-384	3
α-helix	386-399	14
α-helix	404-410	7
α-helix	420-432	13
α-helix	437-446	10
α-helix	452-472	21
α-helix	477-487	11
α-helix	490-495	6
α-helix	500-517	18
α-helix	530-539	10
β-strand	557-558	2	15
α-helix	560-562	3
β-strand	567	1	17
β-strand	571-572	2	15
β-strand	576-577	2	18
β-strand	578	1	19
β-strand	582	1	19
α-helix	583-586	4
α-helix	592-603	12
β-strand	606	1	17
β-strand	611-612	2	15
β-strand	615-617	3	16
β-strand	626	1	16
β-strand	628-629	2	18
α-helix	631-634	4
β-strand	641-642	2	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
33-MER	C, D	DNA	35
DNA helicase II	A, B	protein	680	Escherichia coli	P03018 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>2IS2_1 33-MER (chains C, D)
CGAGCACTGCACTCGAGTGCAGTGCTCGTTGTTAT

Sequence of entity 2 (A, B), FASTA

>2IS2_2 DNA helicase II (chains A, B)
MDVSYLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVENCSPYSIMAV
TFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHGLAHRLLRAHHMDANLPQDFQILDSEDQL
RLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQSYGNPVEQTWQKVYQAYQEA
CDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDT
GKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENN
NGRLGKKLWTDGADGEPISLYCAFNELDEARFVVNRIKTWQDNGGALAECAILYRSNAQS
RVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIVNRNDDAAFERVVNTPTRGIGD
RTLDVVRQTSRDRQLTLWQACRELLQEKALAGRAASALQRFMELIDALAQETADMPLHVQ
TDRVIKDSGLRTMYEQEKGEKGQTRIENLEELVTATRQFSYNEEDEDLMPLQAFLSHAAL
EAGEGQADTWQDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAY
VGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGELPEECVEEVRLRATVSRPVSHQRMG
TPMVENDSGYKLGQRVRHAK

Primary citation

UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke. Lee, J.Y., Yang, W. Cell (2006) 127:1349-1360. DOI 10.1016/j.cell.2006.10.049 · PubMed

Other PDB entries of the same protein (UniProt P03018 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EGS 1.7 Å, The crystal structure of lobe domain of E. coli RNA polymerase complexed with the…
3LFU 1.8 Å, Crystal Structure of E. coli UvrD
2IS6 2.2 Å, Crystal structure of UvrD-DNA-ADPMgF3 ternary complex
2IS4 2.6 Å, Crystal structure of UvrD-DNA-ADPNP ternary complex
2IS1 2.9 Å, Crystal structure of UvrD-DNA-SO4 complex
6YI2 UvrD helicase RNA polymerase interactions are governed by UvrDs carboxy terminal Tudor…

Browse structure collections

About this viewer

MolViewer shows 2IS2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.