2IYL: FtsY:GDP complex

Structure of an FtsY:GDP complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 2 Jan 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: THERMUS AQUATICUS
Chains: 1
Atoms: 2,256
Mol. weight: 31.4 kDa
Ligands: GDP
Released: 2 Jan 2007

Explore 2IYL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IYL contains 12 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	28-41	14
α-helix	46-58	13
α-helix	64-76	13
α-helix	84-88	5
β-strand	104-108	5	1
α-helix	115-128	14
β-strand	133-136	4	1
α-helix	148-156	9
β-strand	160-161	2	1
α-helix	169-182	14
β-strand	187-190	4	1
α-helix	202-216	15
β-strand	223-229	7	1
α-helix	238-247	10
β-strand	251-255	5	1
α-helix	263-265	3
α-helix	266-273	8
β-strand	277-281	5	1
β-strand	289-291	3	1
α-helix	294-301	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division protein ftsy	D	protein	284	THERMUS AQUATICUS	P83749 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>2IYL_1 CELL DIVISION PROTEIN FTSY (chains D)
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDE
RRATLRKLGFNPQKPKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDT
FRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKH
NLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGT
AKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

X-ray structure of the T. aquaticus FtsY:GDP complex suggests functional roles for the C-terminal helix of the SRP GTPases. Gawronski-Salerno, J., Coon 5th., J.S., Focia, P.J. et al. Proteins (2007) 66:984-995. DOI 10.1002/prot.21200 · PubMed

Other PDB entries of the same protein (UniProt P83749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RJ9 1.9 Å, Structure of the heterodimer of the conserved GTPase domains of the Signal Recognition…
2J7P 1.97 Å, GMPPNP-stabilized NG domain complex of the SRP GTPases Ffh and FtsY
1OKK 2.05 Å, Homo-heterodimeric complex of the srp gtpases
2Q9C 2.2 Å, Structure of FTSY:GMPPNP with MGCL Complex
2Q9A 2.24 Å, Structure of Apo FTSY
2Q9B 2.3 Å, Structure of FTSY:GMPPNP Complex
2CNW 2.39 Å, GDPALF4 complex of the SRP GTPases Ffh and FtsY
2XKV 13.5 Å, Atomic Model of the SRP-FtsY Early Conformation

Browse structure collections

About this viewer

MolViewer shows 2IYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.