High resolution structure of human CD59. Determined by X-ray diffraction at 1.15 Å resolution. Released 7 Aug 2007.
Explore 2J8B in 3D Show helices and sheets RCSB PDB PDBe
2J8B contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 1 |
| β-strand | 16-18 | 3 | 1 |
| β-strand | 25-31 | 7 | 2 |
| β-strand | 34-40 | 7 | 2 |
| α-helix | 42-44 | 3 | |
| α-helix | 47-54 | 8 | |
| β-strand | 60-64 | 5 | 2 |
| α-helix | 72-74 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD59 glycoprotein | A | protein | 79 | HOMO SAPIENS | P13987 (AlphaFold model) |
>2J8B_1 CD59 GLYCOPROTEIN (chains A) MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENEL TYYCCKKDLCNFNEQLENG
High-Resolution Structures of Bacterially Expressed Soluble Human Cd59. Leath, K.J., Johnson, S., Roversi, P. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2007) 63:648. DOI 10.1107/S1744309107033477 · PubMed
Other PDB entries of the same protein (UniProt P13987 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2J8B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.