2UWR: Human CD59

High resolution structure of human CD59. Determined by X-ray diffraction at 1.34 Å resolution. Released 7 Aug 2007.

Method: X-ray diffraction
Resolution: 1.34 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 765
Mol. weight: 9.2 kDa
Released: 7 Aug 2007

Explore 2UWR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UWR contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	16-18	3	1
β-strand	25-31	7	2
β-strand	34-40	7	2
α-helix	42-44	3
α-helix	47-54	8
β-strand	60-64	5	2
α-helix	73-76	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD59 glycoprotein	A	protein	79	HOMO SAPIENS	P13987 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2UWR_1 CD59 GLYCOPROTEIN (chains A)
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENEL
TYYCCKKDLCNFNEQLENC

Primary citation

High-Resolution Structures of Bacterially Expressed Soluble Human Cd59. Leath, K.J., Johnson, S., Roversi, P. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2007) 63:648. DOI 10.1107/S1744309107033477 · PubMed

Other PDB entries of the same protein (UniProt P13987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J8B 1.15 Å, High resolution structure of human CD59
2UX2 1.8 Å, High resolution structure of human CD59
2OFS 2.12 Å, Crystal structure of human CD59
5IMY 2.4 Å, Trapped Toxin
8CN6 2.43 Å, CD59 in complex with CP-06 peptide
5IMT 2.7 Å, Toxin receptor complex
8B0F 3.0 Å, CryoEM structure of C5b8-CD59
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
4BIK 3.49 Å, Structure of a disulfide locked mutant of Intermedilysin with human CD59
6ZD0 4.6 Å, Disulfide-locked early prepore intermedilysin-CD59
1CDQ Structure of a soluble, glycosylated form of the human complement regulatory protein CD59

Browse structure collections

About this viewer

MolViewer shows 2UWR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.