8B0H: 2C9, C5b9-CD59 cryoEM structure

2C9, C5b9-CD59 cryoEM structure. Determined by electron microscopy at 3.3 Å resolution. Released 22 Feb 2023.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 9
Atoms: 37,115
Mol. weight: 682.47 kDa
Released: 22 Feb 2023

Explore 8B0H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8B0H contains 182 α-helices and 314 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 43 helices, 95 β-strands

Element	Residues	Length	Sheet
β-strand	22-28	7	24
β-strand	31-32	2	25
β-strand	36-44	9	24
β-strand	50-57	8	26
β-strand	65-73	9	26
α-helix	75-77	3
β-strand	80-86	7	24
α-helix	89-91	3
β-strand	101-108	8	26
β-strand	112-118	7	26
β-strand	119-120	2	25
β-strand	125-130	6	27
β-strand	134-135	2	28
β-strand	140-141	2	29
β-strand	143-148	6	27
β-strand	154	1	27
β-strand	158-164	7	28
β-strand	170-177	8	28
β-strand	182-184	3	27
α-helix	185-187	3
β-strand	188-189	2	29
α-helix	190-191	2
α-helix	194-196	3
β-strand	197-205	9	28
β-strand	213-219	7	28
β-strand	227-233	7	30
β-strand	237-238	2	30
α-helix	240-243	4
β-strand	246-254	9	30
β-strand	259	1	30
β-strand	262-272	11	30
α-helix	280-281	2
β-strand	282	1	30
α-helix	283	1
β-strand	289-293	5	30
β-strand	296-301	6	30
α-helix	303-310	8
α-helix	316-318	3
β-strand	322-331	10	30
β-strand	337-341	5	30
β-strand	345-347	3	30
β-strand	352-356	5	31
β-strand	362-363	2	32
β-strand	369-377	9	31
β-strand	387-395	9	32
β-strand	401-403	3	32
α-helix	404-406	3
β-strand	407-410	4	32
α-helix	411-412	2
β-strand	417-422	6	31
β-strand	430-437	8	32
β-strand	449-456	8	32
β-strand	464-467	4	33
α-helix	475	1
β-strand	476	1	34
α-helix	477	1
β-strand	481-484	4	35
β-strand	486-489	4	33
β-strand	498-505	8	36
β-strand	508-516	9	36
β-strand	517	1	37
α-helix	518	1
β-strand	523	1	37
β-strand	526-529	4	35
α-helix	532-534	3
β-strand	537-546	10	36
β-strand	553-562	10	36
β-strand	563	1	34
β-strand	572-575	4	38
β-strand	581-582	2	39
α-helix	583	1
β-strand	587-593	7	38
β-strand	598-606	9	39
α-helix	607-612	6
α-helix	623-628	6
β-strand	637	1	36
α-helix	642-648	7
β-strand	651-655	5	24
α-helix	661-663	3
β-strand	772-780	9	39
β-strand	783-789	7	38
α-helix	790-791	2
β-strand	795-805	11	39
β-strand	808-811	4	39
β-strand	815-819	5	39
β-strand	823-827	5	40
β-strand	833-834	2	41
β-strand	841-847	7	40
β-strand	853-854	2	42
β-strand	855-857	3	43
β-strand	860-861	2	41
β-strand	865	1	44
α-helix	886	1
β-strand	887-888	2	42
α-helix	889	1
β-strand	892-898	7	40
β-strand	902	1	44
β-strand	906-911	6	41
β-strand	914-916	3	43
β-strand	919-921	3	43
β-strand	924-930	7	41
β-strand	935-944	10	45
β-strand	945	1	46
β-strand	954	1	46
β-strand	956-959	4	47
β-strand	974-982	9	45
β-strand	992	1	48
α-helix	996-1000	5
α-helix	1010-1025	16
α-helix	1029-1032	4
α-helix	1038-1040	3
α-helix	1042-1058	17
β-strand	1060	1	49
β-strand	1066	1	49
α-helix	1073-1074	2
β-strand	1075	1	49
α-helix	1076-1088	13
α-helix	1089-1091	3
α-helix	1094-1096	3
α-helix	1097-1111	15
α-helix	1133-1136	4
α-helix	1141-1156	16
α-helix	1162-1179	18
α-helix	1185-1197	13
α-helix	1203-1214	12
β-strand	1217-1219	3	50
β-strand	1225-1227	3	50
α-helix	1242-1260	19
α-helix	1264-1275	12
α-helix	1287-1307	21
β-strand	1310-1317	8	47
β-strand	1322-1329	8	47
β-strand	1332	1	47
α-helix	1335-1337	3
β-strand	1338-1339	2	45
β-strand	1346-1350	5	47
β-strand	1354	1	47
β-strand	1356-1366	11	45

Chain B: 32 helices, 47 β-strands

Element	Residues	Length	Sheet
α-helix	24-26	3
α-helix	28	1
β-strand	29	1	66
α-helix	30-34	5
β-strand	42-47	6	67
β-strand	48	1	66
α-helix	54-58	5
α-helix	61-64	4
β-strand	68-73	6	67
α-helix	77-79	3
β-strand	80	1	68
β-strand	83-84	2	69
α-helix	85-87	3
α-helix	89-94	6
β-strand	99-103	5	70
β-strand	106-108	3	69
β-strand	110-111	2	68
α-helix	114-116	3
β-strand	122-126	5	70
α-helix	132-133	2
β-strand	144-145	2	71
β-strand	151-152	2	71
α-helix	154-156	3
α-helix	168-170	3
α-helix	184	1
β-strand	185-186	2	72
α-helix	187	1
α-helix	190-194	5
β-strand	195-198	4	2
β-strand	203-207	5	2
β-strand	209	1	73
β-strand	220-222	3	72
α-helix	228	1
β-strand	229-231	3	72
α-helix	232-233	2
β-strand	236-240	5	2
β-strand	244-279	36	2
β-strand	286-327	42	2
β-strand	334	1	73
α-helix	336-344	9
α-helix	351-361	11
β-strand	364-407	44	2
β-strand	412-445	34	2
α-helix	449-457	9
α-helix	466-478	13
β-strand	481-489	9	2
α-helix	490-492	3
α-helix	500-518	19
α-helix	520-522	3
α-helix	524-526	3
β-strand	531-534	4	68
β-strand	538-542	5	68
α-helix	543-544	2
β-strand	547-548	2	74
β-strand	554-555	2	74
β-strand	565	1	75
α-helix	568-577	10
β-strand	582-586	5	76
α-helix	593-594	2
β-strand	595	1	75
α-helix	598-602	5
β-strand	606-610	5	76
β-strand	616	1	48
β-strand	630	1	50
α-helix	635-637	3
α-helix	643	1
β-strand	644-645	2	77
α-helix	646-650	5
β-strand	653-655	3	78
β-strand	661-662	2	77
β-strand	667-669	3	79
β-strand	670-672	3	78
β-strand	676-679	4	80
β-strand	683-685	3	79
β-strand	698-701	4	80
β-strand	703-705	3	81
β-strand	721-723	3	81
β-strand	727-728	2	82
β-strand	744-745	2	82

Chain C: 28 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	26	1	51
β-strand	29-33	5	52
α-helix	34-39	6
β-strand	45-49	5	53
β-strand	50-54	5	52
β-strand	56	1	54
β-strand	57	1	51
α-helix	60-64	5
β-strand	68-72	5	53
α-helix	78-83	6
β-strand	89-90	2	55
β-strand	96-97	2	55
α-helix	99-101	3
α-helix	114-116	3
α-helix	137-141	5
β-strand	142-144	3	2
β-strand	151-154	4	2
β-strand	156	1	56
β-strand	167-169	3	57
α-helix	172-174	3
β-strand	176-178	3	57
β-strand	185-187	3	2
β-strand	191-222	32	2
β-strand	226-263	38	2
α-helix	264-266	3
α-helix	270-271	2
β-strand	272	1	56
α-helix	273	1
α-helix	274-282	9
α-helix	289-299	11
β-strand	302-341	40	2
β-strand	349-378	30	2
α-helix	382-389	8
α-helix	400-409	10
α-helix	414	1
β-strand	415-423	9	2
α-helix	424-427	4
α-helix	434-452	19
α-helix	454-456	3
α-helix	458-460	3
α-helix	464	1
β-strand	465-469	5	54
β-strand	472-476	5	54
β-strand	499	1	58
α-helix	503-510	8
β-strand	513	1	59
β-strand	516-520	5	59
α-helix	527-528	2
β-strand	529	1	58
α-helix	532-535	4
β-strand	540-544	5	59
α-helix	548-556	9
α-helix	558-560	3
β-strand	570	1	60
α-helix	573-577	5
β-strand	580-582	3	61
β-strand	590	1	60
β-strand	594-596	3	62
β-strand	597-599	3	61
α-helix	600	1
β-strand	603-606	4	63
β-strand	610-613	4	62
β-strand	619-621	3	62
β-strand	625-628	4	63
β-strand	630-631	2	64
α-helix	640-641	2
β-strand	642	1	65
β-strand	649-650	2	64
β-strand	657	1	65

Chain D: 20 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	9	1	3
α-helix	10-11	2
β-strand	12-13	2	4
α-helix	14-19	6
α-helix	21-23	3
β-strand	28-32	5	5
β-strand	35-37	3	4
β-strand	39-40	2	3
α-helix	43-47	5
β-strand	51-55	5	5
β-strand	71-72	2	6
β-strand	79-80	2	6
α-helix	82-84	3
β-strand	113	1	7
α-helix	114-115	2
α-helix	118-121	4
β-strand	123-126	4	2
β-strand	131-135	5	2
β-strand	137	1	8
β-strand	149-151	3	7
β-strand	154-156	3	7
β-strand	162-166	5	2
β-strand	170-199	30	2
β-strand	215-252	38	2
β-strand	259	1	8
α-helix	261-268	8
α-helix	276-286	11
β-strand	289-328	40	2
β-strand	345-374	30	2
α-helix	378-385	8
α-helix	389-391	3
α-helix	392-404	13
β-strand	407-415	9	2
α-helix	416-419	4
α-helix	428-446	19
α-helix	448-450	3
α-helix	452-454	3
β-strand	459-463	5	3
β-strand	466-470	5	3
α-helix	471-472	2
β-strand	476	1	9
β-strand	482	1	9
β-strand	493	1	10
α-helix	494-502	9
β-strand	506-509	4	11
β-strand	515	1	10
α-helix	524-527	4
β-strand	531-534	4	11

Chain E: 22 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5
β-strand	10-11	2	13
α-helix	12-19	8
β-strand	21	1	14
β-strand	26-30	5	14
β-strand	33-35	3	13
β-strand	37	1	15
α-helix	42-44	3
β-strand	49-53	5	14
α-helix	62-64	3
β-strand	70-71	2	16
β-strand	78-79	2	16
α-helix	81-83	3
α-helix	103-105	3
α-helix	114	1
β-strand	115	1	17
α-helix	116	1
α-helix	120-123	4
β-strand	124-127	4	18
β-strand	132-136	5	18
β-strand	138	1	19
β-strand	149-151	3	17
β-strand	157-161	5	20
β-strand	166-170	5	20
α-helix	172-174	3
β-strand	175-177	3	17
α-helix	178-179	2
β-strand	182-217	36	2
β-strand	240-273	34	2
β-strand	278	1	21
β-strand	280	1	19
α-helix	282-290	9
α-helix	297-307	11
β-strand	310-312	3	18
β-strand	315-345	31	2
β-strand	369-395	27	2
α-helix	398-406	9
α-helix	410-422	13
β-strand	425-428	4	2
β-strand	431-433	3	18
α-helix	434-440	7
β-strand	441	1	21
α-helix	447-463	17
α-helix	466-468	3
α-helix	476	1
β-strand	477-481	5	15
β-strand	484-488	5	15
β-strand	508	1	22
α-helix	512-519	8
β-strand	525-529	5	23
α-helix	536-537	2
β-strand	538	1	22
α-helix	541-544	4
β-strand	549-553	5	23

Chain F: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	24-27	4
β-strand	29-38	10	12
α-helix	41-44	4
β-strand	53-60	8	12
β-strand	63-72	10	12
β-strand	75-88	14	12
β-strand	91-94	4	12
β-strand	103-111	9	12
β-strand	115-122	8	12
β-strand	125-132	8	12
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	12
α-helix	173-175	3
β-strand	176	1	12

Chain G: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	16-18	3	1
α-helix	19-20	2
β-strand	25-31	7	2
β-strand	34-40	7	2
α-helix	47-54	8
β-strand	58-64	7	2
α-helix	72-74	3

Chain H: 16 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	83
β-strand	23-24	2	84
α-helix	25-32	8
β-strand	34	1	85
β-strand	39-43	5	85
β-strand	46-48	3	84
β-strand	51	1	83
α-helix	54-56	3
β-strand	62-66	5	85
α-helix	72-75	4
β-strand	84-85	2	86
β-strand	91-92	2	86
α-helix	94-96	3
β-strand	104	1	87
β-strand	106	1	87
α-helix	107-109	3
β-strand	127-128	2	88
α-helix	130-134	5
β-strand	138-140	3	2
β-strand	145-147	3	2
β-strand	151	1	89
β-strand	162-164	3	88
β-strand	171-173	3	88
α-helix	174-175	2
β-strand	178-182	5	2
β-strand	185-201	17	2
β-strand	262-265	4	2
β-strand	267-287	21	2
β-strand	294	1	89
α-helix	296-304	9
α-helix	311-321	11
β-strand	324-351	28	2
β-strand	394-409	16	2
α-helix	413-424	12
α-helix	431-440	10
β-strand	446-454	9	2
α-helix	455-458	4
α-helix	466-483	18
α-helix	486-488	3
α-helix	490-492	3
α-helix	496	1
β-strand	497-500	4	83
β-strand	505-508	4	83
β-strand	514	1	90
β-strand	520	1	90

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD59 glycoprotein	G	protein	128	Homo sapiens	P13987 (AlphaFold model)
Complement component C8 beta chain	D	protein	591	Homo sapiens	P07358 (AlphaFold model)
Complement component C8 gamma chain	F	protein	202	Homo sapiens	P07360 (AlphaFold model)
Complement component C8 alpha chain	E	protein	584	Homo sapiens	P07357 (AlphaFold model)
Complement C5	A	protein	1676	Homo sapiens	P01031
Complement component C7	C	protein	843	Homo sapiens	P10643
Complement component C6	B	protein	934	Homo sapiens	P13671
Complement component C9	H, I	protein	559	Homo sapiens	P02748

Sequence of entity 1 (G), FASTA

>8B0H_1 CD59 glycoprotein (chains G)
MGIQGGSVLFGLLLVLAVFCHSGHMLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV
YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL
AAAWSLHP

Sequence of entity 2 (D), FASTA

>8B0H_2 Complement component C8 beta chain (chains D)
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Sequence of entity 3 (F), FASTA

>8B0H_3 Complement component C8 gamma chain (chains F)
MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR

Sequence of entity 4 (E), FASTA

>8B0H_4 Complement component C8 alpha chain (chains E)
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC

Sequence of entity 5 (A), FASTA

>8B0H_5 Complement C5 (chains A)
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence of entity 6 (C), FASTA

>8B0H_6 Complement component C7 (chains C)
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ

Sequence of entity 7 (B), FASTA

>8B0H_7 Complement component C6 (chains B)
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQ
LYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQS
GSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA

Sequence of entity 8 (H, I), FASTA

>8B0H_8 Complement component C9 (chains H, I)
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIY
VLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK

Primary citation

Structural basis for membrane attack complex inhibition by CD59. Couves, E.C., Gardner, S., Voisin, T.B. et al. Nat Commun (2023) 14:890-890. DOI 10.1038/s41467-023-36441-z · PubMed

Other PDB entries of the same protein (UniProt P13987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J8B 1.15 Å, High resolution structure of human CD59
2UWR 1.34 Å, High resolution structure of human CD59
2UX2 1.8 Å, High resolution structure of human CD59
2OFS 2.12 Å, Crystal structure of human CD59
5IMY 2.4 Å, Trapped Toxin
8CN6 2.43 Å, CD59 in complex with CP-06 peptide
5IMT 2.7 Å, Toxin receptor complex
8B0F 3.0 Å, CryoEM structure of C5b8-CD59
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
4BIK 3.49 Å, Structure of a disulfide locked mutant of Intermedilysin with human CD59
6ZD0 4.6 Å, Disulfide-locked early prepore intermedilysin-CD59
1CDQ Structure of a soluble, glycosylated form of the human complement regulatory protein CD59

Browse structure collections

About this viewer

MolViewer shows 8B0H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.