2J9V: Vacuolar protein sorting-associated protein 28

2 Angstrom X-ray structure of the yeast ESCRT-I Vps28 C-terminus. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Jan 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 870
Mol. weight: 11.57 kDa
Released: 23 Jan 2007

Explore 2J9V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J9V contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	150-168	19
β-strand	173	1	1
α-helix	174-191	18
α-helix	199-211	13
α-helix	212-213	2
β-strand	217	1	1
α-helix	220-240	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein 28	A	protein	99	SACCHAROMYCES CEREVISIAE	Q02767 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2J9V_1 VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28 (chains A)
HHHMFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLI
DWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD

Primary citation

Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking. Gill, D.J., Teo, H., Sun, J. et al. EMBO J (2007) 26:600. DOI 10.1038/SJ.EMBOJ.7601501 · PubMed

Other PDB entries of the same protein (UniProt Q02767 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J9U 2.0 Å, 2 Angstrom X-ray structure of the yeast ESCRT-I Vps28 C-terminus in complex with the…
2F6M 2.1 Å, Structure of a Vps23-C:Vps28-N subcomplex
2P22 2.7 Å, Structure of the Yeast ESCRT-I Heterotetramer Core
2F66 2.8 Å, Structure of the ESCRT-I endosomal trafficking complex
2G3K 3.05 Å, Crystal structure of the C-terminal domain of Vps28
2CAZ 3.6 Å, ESCRT-I core

Browse structure collections

About this viewer

MolViewer shows 2J9V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.