2P22: Yeast ESCRT-I Heterotetramer Core

Structure of the Yeast ESCRT-I Heterotetramer Core. Determined by X-ray diffraction at 2.7 Å resolution. Released 5 Jun 2007.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 4,379
Mol. weight: 66.3 kDa
Released: 5 Jun 2007

Explore 2P22 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P22 contains 25 α-helices and 3 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	219-246	28
α-helix	248-251	4
α-helix	254-289	36
α-helix	291-303	13
α-helix	314-316	3
β-strand	318-319	2	1
α-helix	323-351	29
α-helix	356-381	26

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	14-18	5
α-helix	31-57	27
α-helix	64-83	20
α-helix	111-115	5

Chain C: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	23-33	11
α-helix	48-52	5
α-helix	55-57	3
α-helix	62-70	9
α-helix	72-78	7
α-helix	79-82	4
α-helix	86-143	58
α-helix	147-170	24
α-helix	178-205	28
β-strand	211	1	1

Chain D: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	4-11	8
β-strand	15-16	2	1
α-helix	31-34	4
α-helix	37-39	3
α-helix	41-65	25
α-helix	67-78	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease	A	protein	174	Saccharomyces cerevisiae	P25604 (AlphaFold model)
Vacuolar protein sorting-associated protein 28	B	protein	118	Saccharomyces cerevisiae	Q02767 (AlphaFold model)
Protein SRN2	C	protein	192	Saccharomyces cerevisiae	Q99176 (AlphaFold model)
Hypothetical 12.0 kDa protein in ADE3-SER2 intergenic region	D	protein	79	Saccharomyces cerevisiae	P42939 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2P22_1 Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease (chains A)
GAMDISPTNHHEMLQNLQTVVNELYREDVDYVADKILTRQTVMQESIARFHEIIAIDKNH
LRAVEQAIEQTMHSLNAQIDVLTANRAKVQQFSSTSHVDDEDVNSIAVAKTDGLNQLYNL
VAQDYALTDTIECLSRMLHRGTIPLDTFVKQGRELARQQFLVRWHIQRITSPLS

Sequence of entity 2 (B), FASTA

>2P22_2 Vacuolar protein sorting-associated protein 28 (chains B)
MQKHNIKLNQNQDISQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKD
SIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFADTYNITASNAITRLERG

Sequence of entity 3 (C), FASTA

>2P22_3 Protein SRN2 (chains C)
SRLDIIRAEMDVVPSPGLPEKVNEKSKNIPLPEGINLLSSKEIIDLIQTHRHQLELYVTK
FNPLTDFAGKIHAFRDQFKQLEENFEDLHEQKDKVQALLENARILESKYVASWQDYHSEF
SKKYGDIALKKKLEQNTKKLDEESSQLETTTRSIDSADDLDQFIKNYLDIRTQYHLRREK
LATWDKQGNLKY

Sequence of entity 4 (D), FASTA

>2P22_4 Hypothetical 12.0 kDa protein in ADE3-SER2 intergenic region (chains D)
MNVEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKVCQ
LHDSSNKKFDQWYKEQYLS

Primary citation

Molecular architecture and functional model of the complete yeast ESCRT-I heterotetramer. Kostelansky, M.S., Schluter, C., Tam, Y.Y. et al. Cell (2007) 129:485-498. DOI 10.1016/j.cell.2007.03.016 · PubMed

Other PDB entries of the same protein (UniProt P25604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R3Q 1.45 Å, Crystal structure of the yeast Vps23 UEV domain
1UZX 1.85 Å, A complex of the Vps23 UEV with ubiquitin
3R42 1.87 Å, Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide
2F6M 2.1 Å, Structure of a Vps23-C:Vps28-N subcomplex
2F66 2.8 Å, Structure of the ESCRT-I endosomal trafficking complex
2CAZ 3.6 Å, ESCRT-I core

Browse structure collections

About this viewer

MolViewer shows 2P22 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.