2JH2: Cohesin-like module from Clostridium perfringens

Name: PDB 2JH2: X-ray crystal structure of a cohesin-like module from Clostridium perfringens
Published: 2007-11-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hydrolase

X-ray crystal structure of a cohesin-like module from Clostridium perfringens. Determined by X-ray diffraction at 2.5 Å resolution. Released 6 Nov 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: CLOSTRIDIUM PERFRINGENS
Chains: 3
Atoms: 3,029
Mol. weight: 46.66 kDa
Released: 6 Nov 2007

Explore 2JH2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JH2 contains 5 α-helices and 41 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	9-15	7	1
β-strand	19-21	3	2
β-strand	25-36	12	1
β-strand	40	1	3
β-strand	42-49	8	2
β-strand	54-61	8	1
β-strand	65-73	9	2
β-strand	76-83	8	2
α-helix	88	1
β-strand	89	1	3
α-helix	90	1
β-strand	94-102	9	1
β-strand	106-119	14	2
β-strand	125-127	3	2
β-strand	129	1	1
β-strand	131-138	8	2

Chain B: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	9-15	7	4
β-strand	19-21	3	5
β-strand	25-36	12	4
β-strand	40	1	6
β-strand	42-49	8	5
β-strand	54-61	8	4
β-strand	65-73	9	5
β-strand	76-83	8	5
α-helix	87-88	2
β-strand	89	1	6
α-helix	90	1
β-strand	94-102	9	4
β-strand	106-119	14	5
β-strand	125-128	4	5
β-strand	129	1	4
β-strand	131-138	8	5

Chain C: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	7
β-strand	19	1	8
β-strand	25-35	11	7
β-strand	42-48	7	9
β-strand	54-61	8	7
β-strand	65-73	9	9
β-strand	76-83	8	9
α-helix	88-90	3
β-strand	94-102	9	7
β-strand	109-119	11	9
β-strand	125-128	4	9
β-strand	129	1	7
β-strand	131-135	5	9
β-strand	136	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
O-glcnacase nagj	A, B, C	protein	148	CLOSTRIDIUM PERFRINGENS	Q0TR53 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2JH2_1 O-GLCNACASE NAGJ (chains A, B, C)
GSHMASKLKEAAEVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAF
EYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVT
NSSVGDGEGLVHEIAGTEKTVNIIEGTS

Primary citation

Three-Dimensional Structure of a Putative Non- Cellulosomal Cohesin Module from a Clostridium Perfringens Family 84 Glycoside Hydrolase. Chitayat, S., Gregg, K., Adams, J.J. et al. J Mol Biol (2008) 375:20. DOI 10.1016/J.JMB.2007.10.031 · PubMed

Other PDB entries of the same protein (UniProt Q0TR53 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J1A 1.49 Å, Structure of CBM32 from Clostridium perfringens beta-N- acetylhexosaminidase GH84C in…
2OZN 1.6 Å, The Cohesin-Dockerin Complex of NagJ and NagH from Clostridium perfringens
2W1N 1.8 Å, cohesin and fibronectin type-III double module construct from the Clostridium…
2V5C 2.1 Å, Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure
2VUR 2.2 Å, Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death
2CBI 2.25 Å, Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue…
2X0Y 2.25 Å, Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds
2J62 2.26 Å, Structure of a bacterial O-glcnacase in complex with glcnacstatin
2J7M 2.3 Å, Characterization of a Family 32 CBM
7KHV 2.3 Å, Cpoga in complex with ligand 54
2WB5 2.31 Å, GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular…
2CBJ 2.35 Å, Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue…

Browse structure collections

About this viewer

MolViewer shows 2JH2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.