2JOG: Calcineurin-NFAT complex

Structure of the calcineurin-NFAT complex. Determined by solution NMR. Released 22 May 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 2,784
Mol. weight: 39.59 kDa
Released: 22 May 2007

Explore 2JOG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JOG contains 16 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	27-28	2
β-strand	29	1	1
α-helix	30	1
α-helix	31-34	4
β-strand	35	1	2
β-strand	41	1	2
α-helix	43-51	9
β-strand	56	1	1
α-helix	58-74	17
β-strand	78-81	4	3
β-strand	85-88	4	4
α-helix	95-105	11
β-strand	113-115	3	4
α-helix	126-139	14
β-strand	144-146	3	4
α-helix	154-159	6
α-helix	162-169	8
α-helix	172-182	11
β-strand	188-191	4	3
β-strand	195-197	3	3
β-strand	203	1	5
β-strand	206	1	5
α-helix	209-213	5
α-helix	220-222	3
α-helix	226-232	7
β-strand	234-235	2	6
β-strand	248-250	3	6
β-strand	258-260	3	6
α-helix	262-272	11
β-strand	276-279	4	3
β-strand	288-290	3	3
β-strand	293	1	7
β-strand	300	1	7
β-strand	302-305	4	3
α-helix	311-313	3
β-strand	319-325	7	4
β-strand	328-334	7	4
α-helix	344-346	3

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	380-383	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin-dependent calcineurin A subunit alpha isoform	A	protein	327	Homo sapiens	Q08209 (AlphaFold model)
Nfat	B	protein	16

Sequence of entity 1 (A), FASTA

>2JOG_1 Calmodulin-dependent calcineurin A subunit alpha isoform (chains A)
VPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLD
IDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILY
PKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHG
GLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFY
SYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAA
VLKYENNVMNIRQFNCSPHPYWLPNFM

Sequence of entity 2 (B), FASTA

>2JOG_2 NFAT (chains B)
GPHPVIVITGPHEELE

Primary citation

Structure of the Calcineurin-NFAT Complex: Defining a T Cell Activation Switch Using Solution NMR and Crystal Coordinates. Takeuchi, K., Roehrl, M.H., Sun, Z.Y. et al. Structure (2007) 15:587-597. DOI 10.1016/j.str.2007.03.015 · PubMed

Other PDB entries of the same protein (UniProt Q08209 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W73 1.45 Å, High-resolution structure of the complex between calmodulin and a peptide from…
4F0Z 1.7 Å, Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of…
6UUQ 1.85 Å, Structure of Calcineurin bound to RCAN1
2R28 1.86 Å, The complex Structure of Calmodulin Bound to a Calcineurin Peptide
6NUC 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
6NUF 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
4Q5U 1.95 Å, Structure of calmodulin bound to its recognition site from calcineurin
3LL8 2.0 Å, Crystal Structure of Calcineurin in Complex with AKAP79 Peptide
9NXE 2.09 Å, Crystal Structure of Calcineurin Clinical Variant E282K
1AUI 2.1 Å, Human calcineurin heterodimer
9NXN 2.1 Å, Crystal structure of CN:RII alpha
2P6B 2.3 Å, Crystal Structure of Human Calcineurin in Complex with PVIVIT Peptide

Browse structure collections

About this viewer

MolViewer shows 2JOG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.