4F0Z: Calcineurin

Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of the African Swine Fever Virus Protein A238L. Determined by X-ray diffraction at 1.7 Å resolution. Released 6 Mar 2013.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Homo sapiens, African swine fever virus Malawi LIL 20/1
Chains: 3
Atoms: 4,961
Mol. weight: 68.18 kDa
Ligands: CA
Released: 6 Mar 2013

Explore 4F0Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F0Z contains 38 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	22-25	4
α-helix	27-28	2
β-strand	29	1	1
α-helix	30	1
α-helix	31-34	4
β-strand	35	1	2
β-strand	41	1	2
α-helix	43-51	9
β-strand	56	1	1
α-helix	58-73	16
β-strand	78-81	4	3
α-helix	82	1
β-strand	85-88	4	4
β-strand	90	1	5
α-helix	95-105	11
β-strand	113-115	3	4
α-helix	126-139	14
β-strand	144-146	3	4
α-helix	154-159	6
α-helix	162-169	8
α-helix	172-183	12
β-strand	188-191	4	3
β-strand	195-198	4	3
α-helix	210-213	4
α-helix	221-222	2
α-helix	226-232	7
β-strand	234-235	2	6
β-strand	248-250	3	6
β-strand	258-260	3	6
α-helix	262-271	10
β-strand	276-279	4	3
β-strand	288-290	3	3
α-helix	292	1
β-strand	293	1	7
α-helix	294	1
β-strand	300	1	7
β-strand	302-305	4	3
β-strand	306	1	5
α-helix	311-313	3
α-helix	317-318	2
β-strand	319-325	7	4
β-strand	328-334	7	4
α-helix	344-346	3
α-helix	349-369	21

Chain B: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	16-29	14
β-strand	36-37	2	8
α-helix	39-43	5
α-helix	46-48	3
α-helix	54-61	8
β-strand	69-70	2	8
α-helix	71-79	9
α-helix	87-98	12
β-strand	105-106	2	9
α-helix	108-119	12
α-helix	120-122	3
α-helix	125-139	15
β-strand	147-148	2	9
α-helix	149-156	8
α-helix	157-159	3

Chain C: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	206	1
β-strand	207-211	5	4
α-helix	214-216	3
α-helix	219-223	5
α-helix	231-233	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	A	protein	372	Homo sapiens	Q08209 (AlphaFold model)
Calcineurin subunit B type 1	B	protein	170	Homo sapiens	P63098 (AlphaFold model)
Ankyrin repeat domain-containing protein A238L	C	protein	43	African swine fever virus Malawi LIL 20/1	O36972

Sequence of entity 1 (A), FASTA

>4F0Z_1 Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (chains A)
GHMSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEE
SVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGD
YVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDAC
MDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLED
FGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTG
FPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVG
EKVTEMLVNVLN

Sequence of entity 2 (B), FASTA

>4F0Z_2 Calcineurin subunit B type 1 (chains B)
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Sequence of entity 3 (C), FASTA

>4F0Z_3 Ankyrin repeat domain-containing protein A238L (chains C)
GHMRRFKKKPKIIITGCEDNVYEKLPEQNSNFLCVKKLNKYGK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. Grigoriu, S., Bond, R., Cossio, P. et al. PLoS Biol (2013) 11:e1001492-e1001492. DOI 10.1371/journal.pbio.1001492 · PubMed

Other PDB entries of the same protein (UniProt Q08209 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W73 1.45 Å, High-resolution structure of the complex between calmodulin and a peptide from…
6UUQ 1.85 Å, Structure of Calcineurin bound to RCAN1
2R28 1.86 Å, The complex Structure of Calmodulin Bound to a Calcineurin Peptide
6NUC 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
6NUF 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
4Q5U 1.95 Å, Structure of calmodulin bound to its recognition site from calcineurin
3LL8 2.0 Å, Crystal Structure of Calcineurin in Complex with AKAP79 Peptide
9NXE 2.09 Å, Crystal Structure of Calcineurin Clinical Variant E282K
1AUI 2.1 Å, Human calcineurin heterodimer
9NXN 2.1 Å, Crystal structure of CN:RII alpha
2P6B 2.3 Å, Crystal Structure of Human Calcineurin in Complex with PVIVIT Peptide
6NUU 2.3 Å, Structure of Calcineurin mutant in complex with NHE1 peptide

Browse structure collections

About this viewer

MolViewer shows 4F0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.