2JX2: Solution conformation of RNA-bound NELF-E RRM

Solution conformation of RNA-bound NELF-E RRM. Determined by solution NMR. Released 8 Apr 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 663
Mol. weight: 13.38 kDa
Released: 8 Apr 2008

Explore 2JX2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JX2 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	39	1	1
β-strand	40-45	6	2
α-helix	51-58	8
β-strand	64-70	7	2
β-strand	75-80	6	2
α-helix	83-93	11
β-strand	96-97	2	3
β-strand	102-103	2	3
β-strand	104-107	4	2
β-strand	116	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Negative elongation factor E	A	protein	121	Homo sapiens	P18615 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JX2_1 Negative elongation factor E (chains A)
MGSSHHHHHHSSGLVPRGSHMGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSP
FGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGK
S

Primary citation

NELF-E RRM Undergoes Major Structural Changes in Flexible Protein Regions on Target RNA Binding. Rao, J.N., Schweimer, K., Wenzel, S. et al. Biochemistry (2008) 47:3756-3761. DOI 10.1021/bi702429m · PubMed

Other PDB entries of the same protein (UniProt P18615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
8JJ6 2.72 Å, Structure of the NELF-BCE complex
5OOB 2.79 Å, Complex of human nuclear cap-binding complex with M7GTP and nelf-E C-terminal peptide
8UHD 2.8 Å, Structure of paused transcription complex Pol II-DSIF-NELF - post-translocated
6GML 3.2 Å, Structure of paused transcription complex Pol II-DSIF-NELF
9J0O 3.3 Å, Arrested elongation complex of mammalian RNA polymerase II with nucleosome (AEC1-nuc)
9J0P 3.3 Å, Arrested elongation complex of mammalian RNA polymerase II with nucleosome (AEC2-nuc)
9J0N 3.4 Å, Paused elongation complex of mammalian RNA polymerase II with nucleosome (PEC2-nuc)
8UHA 3.5 Å, Structure of paused transcription complex Pol II-DSIF-NELF - tilted
8W8E 3.9 Å, human co-transcriptional RNA capping enzyme RNGTT
7YCX 4.18 Å, The structure of INTAC-PEC complex

Browse structure collections

About this viewer

MolViewer shows 2JX2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.